slender




FC2SQTEFSDSSGVHDASDDASDCAWDSSNIATIDMIDEROYDAVSAAUKGHNDKSBJMIDVSANVEMANACRVENUKBI

2021-06-24
123 min

[DLDSS-012]Whole Body Experience: Massage Parlor Slut Drains Your Balls Dry Tina Nanami

  • nanami tina censoredsingle workDLDSSdahliaflagmanDLDSS-012DLDSS0121dldss00012
    • 2021-06-24
    76 min

    435MFC-118 [SEX Kitchen Slender Slut] SEX is the only way to relieve stress! Big cock violently blames the delicate body of the perverted beauty Luna, and a large amount of vaginal cum shot & facial cum shot! [Shiroto Gonzo ＃ Luna ＃ 24 years old ＃

  • amateur censoredcreampieamateurmfcmfc-118mfc118435mfc-118
    • 2021-06-23
    58 min

    SIRO-4551 [First shot] [Super whitening x Super beautiful breasts] A 23-year-old slender beauty who fascinates the naked body of God. For that beautiful skin that even touches it with a sense of immorality .. AV application on the net → AV experience

  • amateur censoredamateursirosiro-4551siro4551siro-4551
    • 2021-06-23
    59 min

    FC2PPV 1884379 [3980 → Limited number 2980] [First and last complete appearance] 170/42 model class beautiful wife ❤️ 1 hour white day secret meeting ❤️ Slender body held by her husband last week ❤️ Others stick in the womb ❤️

  • amateur uncensoredfc2
    • 2021-06-22
    50 min

    FC2PPV 1882401 The first Gonzo of the active layer. Fair-skinned Loris slender, vaginal cum shot in a tiny pussy.

  • amateur uncensoredfc2
    • 2021-06-22
    57 min

    324SRTD-0231 Creampie For A Drunk Girl! / Sudden change when a girl who is drunk and has no resistance feels! He laughed and forgave me for vaginal cum shot

  • amateur censoredcreampieamateursrtdsrtd-0231srtd0231324srtd-0231
    • 2021-06-22
    96 min

    261ARA-494 [Spilling Big Breasts] [Successful College Students] Rui-chan Visits! H-cup busty beauty with outstanding fluffy power sways just by walking vibration "I’m interested in sex ♪" and applied for AV! I’m crazy about your boo

  • amateur censoredbig titsamateuraraara-494ara494261ara-494
    • 2021-06-22
    58 min

    499NDH-024 Mouth Service is the Best Proof of Love! Axillary, navel, fingers, rimming, licking and sucking large-scale behavior! Saddle tide dripping raw Saddle hope Ma ○ Ko is pierced with a gun and facial cumshots on a too licking beauty who expres

  • amateur censoredcreampiesquirtingndhndh-024ndh024499ndh-024
    • 2021-06-21
    51 min

    FC2PPV 1880908 [3480 → Limited number 2480] Tall beautiful legs ❤️ Whitening nice ass ❤️ ● Elegant intellectual beauty ❤️ Sex for the first time in 2 years ❤️ Innocent slender beauty dies ❤️ Plenty of Tokuno sperm seeded in the womb ❤️

  • amateur uncensoredfc2
    • 2021-06-21
    81 min

    259LUXU-1437 Luxury TV 1420 A professional dancer with a brown body who captivated the men of the world is back on Luxury TV! I can not forget the pleasure I tasted last time, sprinkle overflowing eros, shake the beautiful body wearing lotion and dis

  • amateur censoredbig titsamateurluxuluxu-1437luxu1437259luxu-1437
    • 2021-06-20
    79 min

    300MAAN-666 [Miracle Beauty Constriction White Gal x Netrase Creampie 3 Barrage] Accompanied by the first boyfriend in the series! Beautiful skin white gal and Netrase dense sexual intercourse on the superb view terrace! Strangling for intense spanki

  • amateur censoredcreampieamateurmaanmaan-666maan666300maan-666
    • 2021-06-20
    54 min

    SIRO-4494 AV application on the net → AV experience shooting 1567 [First shot] [Face level S class] [Slender body that shines] I am curious about cute faces and naughty things. Take off the clothes of a fashionable active female college student, a ho

  • amateur censoredsquirtingamateursirosiro-4494siro4494siro-4494
    • 2021-06-20
    135 min

    [GENM-083]Challenge to Attack! Instructions And Pleasure Techniques From A Masochistic Man - With Kira Tsukishiro

  • tsukishiro kira censoredhandjobsingle workGENMgenekigoldfish dGENM-083GENM083genm00083
    • 2021-06-20
    105 min

    300MIUM-718 [Beautiful E Breasts Older Sister] Rent an elegant esthetician as her! Completely REC the whole story that was spoiled up to the originally prohibited erotic acts by persuading! !! After enjoying a date in Yokohama, have rich sex at the h

  • amateur censoredcreampieamateurmiummium-718mium718300mium-718
    • 2021-06-20
    73 min

    476MLA-042 [Secretary of the most erotic president of Reiwa] [Extreme of Sase God] Overnight with all the guests of Happening bar (20 people) and a transcendent spear man! Gap between loose and neat appearance and sexual orientation ◎ 2 consecutive v

  • amateur censoredcreampieamateurmlamla-042mla042476mla-042
    • 2021-06-19
    220 min

    [REXD-366]The Girl Who Used To Bully Me... The Defeated Older Woman "Do You Remember Me？"

  • censoredcreampiebig titsREXDredgroupREXD-366REXD366rexd00366
    • 2021-06-19
    75 min

    491TKWA-009 Mizuna

  • amateur censoredcreampieuniformtkwatkwa-009tkwa009491tkwa-009
    • 2021-06-19
    140 min

    [CAWD-237]She Took Off Her Hoodie To Reveal A Super Slim Body!! This Tall College Girl Works At A Crepe Shop 3 Seriously Orgasmic, Spasmic Fucks In Her Adult Video Debut!! Aira Ochi

  • aira ochi censoredsingle workCAWDkawaiimametaro mamezawaCAWD-237CAWD237cawd00237
    • 2021-06-19
    130 min

    [DASD-877]Your Parents Went Away On Vacation: Your Lust For Your C***dhood Friend Unleashed, Creampie Sex Caught On Camera. Minami Hatsukawa

  • hatsukawa minami censoredcreampiesingle workDASDdasjo asagiriDASD-877DASD877dasd00877
    • 2021-06-19
    240 min

    [REXD-369]Stress Relief! Fat Burning! Dark Boxer Size. Now, Take A Deep Breath...

  • censoredcreampiebig titsREXDredmanji groupREXD-369REXD369rexd00369
    • 2021-06-19
    56 min

    491TKWA-011 Mizuna 2

  • amateur censoredcreampieamateurtkwatkwa-011tkwa011491tkwa-011
    • 2021-06-19
    146 min

    [CAWD-242]Tempting Knee High x Total Domain: HinanoTachibana

  • hinano tachibana censoredsingle workCAWDkawaiitake dCAWD-242CAWD242cawd00242
    • 2021-06-19
    118 min

    [JUL-610]Ann Komatsu (Our Major Exclusive Actress) x A Super Sure Thing (The "Shared Room" Series)!! I Was On A Business Trip, And To My Surprise, I Was Booked Into A Shared Room At The Business Hotel With My Favorite Lady Boss

  • anzu komatsu censoredmature womansingle workJULmadonnamametaro mamezawaJUL-610JUL610jul00610
    • 2021-06-19
    120 min

    [DASD-880]Total Control - Beautiful Girl With Big Tits Made To Want It - Spell Transforms Her Into A Slut Miyuki Arisaka

  • arisaka miyuki censoredcreampiebeautiful girlDASDdasrokusaburo mishimaDASD-880DASD880dasd00880
    • 2021-06-19
    70 min

    200GANA-2510 Seriously Nampa, first shot. 1650 "Longing for City Girl …" Bring the up-and-coming man who has just come to Tokyo to the hotel! A beautiful girl who has been baptized in the city leaks the tide and her breath constantly tre

  • amateur censoredsquirtingamateurganagana-2510gana2510200gana-2510
    • 2021-06-19
    118 min

    [CAWD-230]S*****t Lets Her Home Room Teach Her Creampie Her 'Til He Drops. Nozomi Kitashiro

  • nozomi kitajo censoredcreampieschoolgirlCAWDkawaiikyoseiCAWD-230CAWD230cawd00230
    • 2021-06-19
    121 min

    [HND-997]This Temporary Worker Is An Unlucky Girl Who Only Makes 170,000 Yen Per Month, But The Truth Is That She Has A Powerful Sex Drive And The Only Thing She Was Looking Forward To Was This Adult Video Shoot, And Now She's Making Her Bashful

  • nagisazawa censoredcreampieblowjobHNDhon nakabacon tanakaHND-997HND997hnd00997
    • 2021-06-19
    151 min

    [HND-999]"Honestly, I'd Rather Do It Without The Condom." Sensitive F-Cup College Girl's First Raw Creampie Yuika Aoi

  • yuka aoi censoredcreampiebig titsHNDhon nakausa pyonHND-999HND999hnd00999
    • 2021-06-19
    155 min

    [JUL-613]She Looks Delicate But She Loves It Rough. Teeny Tiny Wife Rika Aohitsugi, Age 28, Makes Her Porn Debut

  • ao coffin censoredmature womansingle workJULmadonnamametaro mamezawaJUL-613JUL613jul00613
    • 2021-06-19
    120 min

    [HND-996]A Fresh Face Girls Like This Really Exist! A Highly-Educated Dick-Eating Real-Life National University S*****t Is Begging To Be Fucked By An Erotically Intelligent Adult Video Actor And Cumming Together In Creampie Ecstasy During Her Adult V

  • mitsu kano censoredcreampieHNDbooktiger gavelHND-996HND996hnd00996
    • 2021-06-19
    180 min

    [JUL-611]No: A Beautiful Woman With Thorns Yes: A Married Woman With Gaps - Sakuraka Mizuki 28 Years Old AV Debut!!

  • sakuraka mizuki censoredmarried womanmature womanJULmadonnakannana dynanaJUL-611JUL611jul00611
    • 2021-06-19
    117 min

    [JUL-616]Maiko Ayase Is An Actress On Our Roster, And She's Getting Sweaty And Furious In A Deep And Richly Unfaithful Plunge Into Pleasure!! Deep And Rich Sex - A Married Woman Female Teacher Goes Down The Path of Ruin In A Forbidden Lusty Relat

  • maiko ayase maria sawaguchi censoredmature womansingle workJULmadonnarokusaburo mishimaJUL-616JUL616jul00616
    • 2021-06-19
    147 min

    [HND-998]Y********l With Soft White Skin From The Northeast Has Raw Sex For The First Time Mitsuki Hirose

  • mitsuki hirose censoredcreampiebeautiful girlHNDhon nakausa pyonHND-998HND998hnd00998
    • 2021-06-18
    57 min

    Caribbeancom 061821-001 Special Lesson After School: Please Play With Remote Control Rotor Anri Kizuki

  • anri kizuki uncensoredcreampiecaribbeancom
    • 2021-06-18
    88 min

    277DCV-184 Is it okay to send it home？ case.178 The moment of insertion is irresistible! A big smile … A gal who said "I’m so excited …" "I’m dying because it feels so good …" ⇒ Good! Good sensitivity! Iku

  • amateur censoredamateurdcvdcv-184dcv184277dcv-184
    • 2021-06-18
    89 min

    [MBDD-2056]Haruka Morimoto/Secret Love

  • haruka morimoto censoredbeautiful girlsingle workMBDDmedia brandMBDD-2056MBDD2056301mbdd02056
    • 2021-06-18
    75 min

    [FTHT-016](Coming Out As A Sub! She Loves To Get Face Fucked Hard! She Loves To Have Her Nipples Teased With A Vibrator) You'd Never Know This Sweet, Obedient Honor S*****t Was A Shaved Pussy Nympho! She Wants You To Nail Her As Hard As You Can I

  • censoredcreampieFTHTfalenodavielfalenotubeFTHT-016FTHT0161ftht00016
    • 2021-06-18
    93 min

    483SGK-029 [Dantotsu Do Nasty] [Frenzy Climax Monster] [Dripping Daddy] [Iki Mad Peeing] Dantotsu Do Nasty Older Sister Invades! The drool is drooling and it’s crazy! !! That figure is exactly … a nasty climax monster! !! !! Convulsions jer

  • amateur censoredbig titssquirtingsgksgk-029sgk029483sgk-029
    • 2021-06-17
    68 min

    435MFC-116 [Beautiful girl with pink nipples with moe sleeves] Meeha girls and raw squirrels who request takeaway with a brute force gesture! The pink nipple that shines at the tip of the fascinating body with outstanding style explodes with a lot of

  • amateur censoredcreampieamateurmfcmfc-116mfc116435mfc-116
    • 2021-06-17
    58 min

    SIRO-4554 [First shot] [Before getting married ..] A slender hairdresser who is engaged with her boyfriend in the same year appears. Pleasure that can not be tasted by a boyfriend who has been dating for 10 years .. AV application on the net → AV exp

  • amateur censoredmarried womanamateursirosiro-4554siro4554siro-4554
    • 2021-06-17
    154 min

    [TIKB-111](Fuck Diary) Miho Tono Goes Wild When She's Had A Little Liquor - Full-Throttle POV Footage!

  • miho tsuno censoredcreampiesingle workTIKBtikitiki.comerTIKB-111TIKB111tikb00111
    • 2021-06-17
    180 min

    [ABW-106]中出し やりたい放題 9 結城るみな 【MGSだけのおまけ映像付き 15分】

  • amateur censoredcreampieamateurabwabw-106abw106abw-106
    • 2021-06-17
    120 min

    [KSBJ-142]My Son's Wife Is A Total Slut... Yuha Kiriyama

  • kiriyama yuu censoredcreampiemarried womanKSBJksb kikaku emmanuellebito sakuraKSBJ-142KSBJ142
    • 2021-06-17
    111 min

    [VENX-048]Once A Month Sex Between A Step Mother And Her Step Son Who Moved To The City I'm On My Way To Be Fucked By My Step Son Again Hana Shirato

  • white peach censoredcreampiemature womanVENXvenuskaniefakecest winntersVENX-048VENX048venx00048
    • 2021-06-17
    150 min

    [ABW-105]からかい上手の野々浦さん。 いつも僕を弄ぶ野々浦さんと青春イチャラブ3本番！！ 野々浦暖

  • amateur censoreduniformamateurabwabw-105abw105abw-105
    • 2021-06-17
    70 min

    FCP-023 [Distribution only] You can’t do it without permission, right？ Faint in agony! Dimension stop oil handjob! !! 1

  • amateur censoredamateurslutfcpfcp-023fcp023fcp-023
    • 2021-06-17
    146 min

    [AKDL-117](She'll Fuck At School) She Looks Radiant In Her Gymnastics Tights - Your Classmate Fuckbuddy Will Swallow Your Cum In Both Holes - Creampie Record - Narumi, Age 18 Nasumi Hirose

  • narumi hirose censoredbeautiful girlAKDLaquinoriaquinoriaknrAKDL-117AKDL1171akdl00117
    • 2021-06-17
    110 min

    [NCYF-011]A Serious Five-Way Large Orgies Fuck Fest! Meet A Beautiful Girl Cosplayer Who Stands 130cm Tall And Has A Teeny Tiny Body! "You're Going To Break My Pussy!" We're All Taking Turns Shoving Our Big Fat Cocks Into Her Tiny Rig

  • censoredcreampiesquirtingNCYFall japan amateur photographers union daudagawaNCYF-011NCYF011ncyf00011
    • 2021-06-17
    119 min

    [MRSS-114]My Beloved Wife Has Been Taking Creampies From My Playboy Coworker - I Found Their Fuck Videos Saved On Her Phone Natsuki Takeuchi

  • natsuki takeuchi censoredcreampiesingle workMRSSmisesu no sugao emmanuelleichiro yumisakimisses amateur faceMRSS-114MRSS114mrss00114
    • 2021-06-17
    127 min

    [BIJN-201]THE Document: Instinct Exposed Through Orgasmic SEX - Horny Slender Babe's Thick Dick Orgy Ayaka Muto

  • ayaka muto censoredcreampiemature womanBIJNbijin majo emmanuelleBIJN-201BIJN201bijn00201
    • 2021-06-16
    121 min

    [FOCS-005]Miss Porn Star Manager... Let's Try To Cum Our Best - The Truth Is, I'm Worried About My Performance... But I Finally Did It!

  • censoredbeautiful girlFOCSabc mousouzokufocusFOCS-005FOCS005focs00005
    • 2021-06-16
    120 min

    [SSIS-093]There's Nothing To Do In This Podunk Town, So I Spend My Days Nailing The Slim, Innocent Babe Next Door - Sweaty Summer Sex Mako Iga

  • iga mako censoredslutsingle workSSISs1 no 1 styleichigoharaSSIS-093SSIS093ssis00093
    • 2021-06-16
    118 min

    [SSIS-096]Nailing My Obedient Lover Until My Balls Are Drained Dry - All-Night Fuckathon 6-Load Adultery Trip Sayaka Otoshiro

  • otoshiro sayaka censoredbeautiful girlsingle workSSISs1 no 1 stylehirokoji osakiSSIS-096SSIS096ssis00096
    • 2021-06-16
    120 min

    [TPPN-196]Incredible Beauties Are Ready For Glistening, Sweat-Drenched Sex! She's Ready To Fall For You Body And Soul - Prisoner Of Passion Pushed To Her Upper Limit

  • censoredblowjobTPPNteppanTPPN-196TPPN196tppn00196
    • 2021-06-16
    150 min

    [SSIS-089]She'll Make You Cum Around The Clock - 24 Hours Of Wild Orgasmic Fucking - The Sex Of A Lifetime With Tsukasa Aoi

  • tsukasa aoi censoredsquirtingsingle workSSISs1 no 1 stylemon cSSIS-089SSIS089ssis00089
    • 2021-06-16
    477 min

    [OFJE-319]Arina Squirts! Splish Splash Gushing Geyser! Have You Ever Seen Sex This Wet In Your Life？! Arina Hashimoto

  • there is hashimoto censoredsquirtingbeautiful girlOFJEs1 no 1 styleOFJE-319OFJE319ofje00319



    • Japan xxx, japanese adult videos, japani sexy, Japanese Adult Movies, JAV censored, Japanese tube, Japanese sex online