no condomskin




FC2SSNIAUKGCAWDHMNMILKHNDPPPDMIDVHDKASDABVENUAMBIBLKKSBJNATRWAAAIPXJULROYDCHRV

2020-10-22
121 min

[FSDSS-112]Suzume Mino Runs Away!？ Slut Awakening Inspired By A Masochistic Amateur!

  • suzume mino censoredamateurblowjobFSDSSfalenosuisei akaifaleno starFSDSS-112FSDSS1121fsdss00112
    • 2020-10-24
    71 min

    FC2PPV 1544469 [Goddess GET] Picking up two girls who were in the cat cafe to teach muscle training. It’s a thin point! If you push the pussy, you will get estrus and orgy Gonzo [firm seeding]

  • amateur uncensoredfc2
    • 2020-10-30
    26 min

    483HMHI-602 Sara

  • amateur censoredbig titsamateurhmhihmhi-602hmhi602hmhi-602
    • 2020-11-06
    490 min

    [JDL-060]Miki Matsuzaka Complete Works - 8 Hours, 2-disc Set

  • miki matsuzaka censoredbig titsmature womanJDLrubyJDL-060JDL060jdl00060
    • 2020-11-11
    108 min

    SRT-019 Su-chan

  • amateur censoredcreampieamateursrtsrt-019srt019srt-019
    • 2020-11-15
    240 min

    [PYM-356]Self Shots Dildo-Loving Cum-Filled Masturbation

  • censoredsquirtingschoolgirlPYMprimoPYM-356PYM356h-283pym00356
    • 2020-11-22
    150 min

    [CAWD-149]Collecting Endangered Species Of Super Masochist Party Gal

  • censoredCAWDkawaiiCAWD-149CAWD149cawd00149
    • 2020-11-28
    148 min

    [JUFE-228]Black Guy Hard Press Fuck NTR My Prized Girlfriend Is Taken By A Low-Life Foreign Exchange S*****t... Nene Tanaka

  • nene tanaka censoredcreampiebig titsJUFEfitchJUFE-228JUFE228jufe00228
    • 2020-12-05
    65 min

    FC2PPV 1595290 [Personal shooting] ♀285OL ◯ Mi-chan 23 years old 1st time No night work experience! A completely amateur tall beautiful breasts slender beauty conceives a vaginal cum shot and ends her life with her AV debut! (LOL)

  • amateur uncensoredfc2
    • 2020-12-06
    240 min

    [YLWN-144]Busty MILFs Only! Can You Tempt A Business Hotel Massage Girl Into Sex？ 240 Minutes

  • censoredamateurmature womanYLWNyellow moonpappan tateishiYLWN-144YLWN144ylwn00144
    • 2020-12-17
    50 min

    H0930 ki201217 Akemi Kawabata 37years old

  • amateur uncensoredh0930
    • 2020-12-17
    78 min

    420HOI-153 Sakuran

  • amateur censoredamateurbeautiful girlhoihoi-153hoi153hoi-153
    • 2020-12-18
    134 min

    [ABW-036]I Went With A Beautiful Girl To A Private Hot Spring Resort, And Had Deep And Rich Sex With Her. 11 I Had A One-Night Private Reservation With A Totally Beautiful Girl, And I Spent It With Her At A Hot Spring Resort Deep In The Mountains Min

  • minase nagase censoredbig titssquirtingABWprestigeabsolutely wonderfulABW-036ABW036118abw00036
    • 2020-12-18
    289 min

    [KFNE-069]Christmas Pick Up vol. 3

  • censoredamateurcosplayKFNEprestigekurofune prestigeKFNE-069KFNE069118kfne00069
    • 2020-12-26
    112 min

    390JAC-073 [God Iki Goddess x Big Breasts H Cup x Raw Saddle 4 Barrage] “My wish is to squeeze all sperm” Ultimate H huge breasts gal who fell down on the gal! !! Explosion! convulsions! Great cum! I repeat it over and over again! !! I don&

  • amateur censoredcreampiebig titsjacjac-073jac073390jac-073
    • 2021-01-07
    127 min

    [JRZE-020]She's Entering The Biz At 50! Kiyo Morino

  • takayo morino censoredcreampiemature womanJRZEcenter villagedaichi minamijurakuJRZE-020JRZE020h-086jrze00020
    • 2021-01-09
    44 min

    FC2PPV 1637558 [Big breasts] Rookie H cup! Shake! Sandwich! Fucking and vaginal cum shot! What can I do if I win the game？ Former virgin may also explode due to tension explosion! ？？ Thank you for your boobs! * Complete appearance

  • amateur uncensoredfc2
    • 2021-01-12
    79 min

    [LOOTA-032]Lolita - Kannon Momojiri

  • momojiri kanon censoredsingle workLOOTAsupa kubijonLOOTA-032LOOTA0325433loota00032
    • 2021-01-14
    44 min

    H4610 ki210114 Saeko Souda 22years old

  • amateur uncensoredh4610
    • 2021-01-15
    205 min

    [BAZX-266]The Total Domain Of A Beautiful Y********l In Uniform Who Wants To Be Watched What A Slut vol. 002

  • censoredcreampieuniformBAZXbazookatodoBAZX-266BAZX266h-1496bazx00266
    • 2021-01-20
    97 min

    [DOKI-010]Me And My Female Senior Got Stuck Alone In A Room After We Missed The Last Train On Our Way Home After A D***king Party.

  • soko manami oura censoredcreampieamateurDOKIstar paradisedokiDOKI-010DOKI010h-254doki00010
    • 2021-01-21
    51 min

    C0930 ki210121 Nagiko Miyama 45years old

  • amateur uncensoredc0930
    • 2021-01-26
    138 min

    [STARS-335]She Came So Hard With Piston-Pumping Vibrator Strokes That She Started Pissing Herself... "I Told You I Already Came!" Even After Cumming, She's Getting Her Pussy Pumped All The Way To The Core In A Super Follow-Up Piston-Pound

  • natsume hibiki censoredbig titsbeautiful girlSTARSsod createkomatsu 17sod starSTARS-335STARS3351stars00335
    • 2021-01-29
    48 min

    490FAN-093 Nao

  • amateur censoredbig titsamateurfanfan-093fan093490fan-093
    • 2021-01-29
    135 min

    [GYAN-011]Going On An Exhibitionist Date - Slut Loves To Fuck Outdoors "Go Ahead, Creampie Me" This Sweet, Horny Nympho Gives The Green Light To Cum Inside Her At The First Interview - Dildo-Bike Leads To Earth-Shattering Orgasms And Lust For

  • censoredGYANprestigehimurokkugyan prestigeGYAN-011GYAN011118gyan00011
    • 2021-02-05
    71 min

    300NTK-513 SEX apt! !! A beautiful gamer with a tall F cup! !! Even if you lose the punishment game, you can win at the woman on top posture! !! Two shots of continuous vaginal cum shot with E-sports sex of lack of exercise & libido elimination o

  • cmfjd censoredcreampieamateurntkntk-513ntk513300ntk-513
    • 2021-02-17
    61 min

    Caribbeancom 021721-001 Luxury Adult Healing Spa: Kurumi Kokoro

  • kurumi kokoro uncensoredcreampiecaribbeancom
    • 2021-02-18
    52 min

    [oretd-844]MIU 2

  • amateur censoredcreampieuniformoretdoretd-844oretd844oretd-844
    • 2021-02-21
    150 min

    [JUL-481]Bridal Massage Parlor NTR - A Slender Wife Who Falls To A Therapist's Indecent Fingertips - Nozomi Higashi

  • nozomi higashi censoredcreampiemature womanJULmadonnaorion chairJUL-481JUL481jul00481
    • 2021-03-02
    69 min

    [IMPNO-032]"Does Sex Feel Good？" Imoka Onono

  • i m afraid censoredanalsingle workIMPNOimpactnon label impactIMPNO-032IMPNO032h-1154impno00032
    • 2021-03-04
    59 min

    FCP-003 [Delivery only] Completely subjective! !! G cup or more that completely wraps Ji ● Ko … Superb big tits fucking ＃ 3

  • amateur censoredbig titsamateurfcpfcp-003fcp003fcp-003
    • 2021-03-26
    75 min

    [393OTIM-066]【妄想主観】冴えないオジサンが大好きな巨乳でスケベな女の子とねっとり相部屋ラブホで援●交際 詩音乃らん

  • amateur censoredcreampiebig titsotimotim-066otim066393otim-066
    • 2021-04-09
    150 min

    [JUFE-276]Blowjob-Loving Slut - F-Cup College Girl Yumeka Kikukawa Getting A Science Degree Makes Her Porn Debut! She Loves The Feel Of Living Things In Her Mouth

  • yumeka kikukawa censoredbig titsblowjobJUFEfitchmichiru arashiyamaJUFE-276JUFE276jufe00276
    • 2021-04-09
    230 min

    [PARATHD-3166]Will Masseuses At Business Hotels Around The Country Let Us Fuck Them？ 4 Hour Special (4) ~ Aomori / Morioka / Fukui / Kanezawa / Shinyokohama / Hamamatsu Version

  • censoredbig titsPARATHDparadise tvPARATHD-3166PARATHD3166parathd03166
    • 2021-04-15
    247 min

    [NATR-656]Totally! Chie Nakamura

  • tomoe nakamura censoredcreampiebig titsNATRpinknadeshikoNATR-656NATR656natr00656
    • 2021-05-14
    273 min

    [HUNTB-017]"Hey, So Do You Want To Fuck Me That Badly ...？ Well, I Don't Really Mind ..." My Big Stepsister Turned Out To Be A Super Horny Neat And Clean Slutty Bitch Who Enjoys Preying On Cherry Boy Cocks! I Suddenly Ended Up With A New

  • censoredcreampieblowjobHUNTBhuntervolvo nakanohhh groupHUNTB-017HUNTB017huntb00017
    • 2021-06-11
    430 min

    [KRU-118]Nice Married Masseuse In A Massage Parlor Without A Happy Ending Smiles And Does It Anyway If You Ask Her!

  • censoredcreampiebig titsKRUkarmamanji groupKRU-118KRU118kru00118
    • 2021-06-16
    146 min

    [ROYD-059]When You Pressed Your Dick Up Against Your Cheeky Coworker You Thought For Sure She'd Be Mad, But Instead It Felt So Good You Ended Up Fucking Until Dawn Yuno Hanasaki

  • yuno hanasaki censoredcreampieblowjobROYDroyalcognac kaminohhh groupROYD-059ROYD059royd00059
    • 2021-07-02
    149 min

    [SHKD-955]G*******g Plan: College Girl Edition - Ichika Nagano

  • ichika nagano censoredsingle workSHKDattackerssharkSHKD-955SHKD955shkd00955
    • 2021-07-05
    74 min

    259LUXU-1427 Luxury TV 1426 "My body is aching …" I have been sexless for 3 years and my desires have accumulated and my body is the limit of patience! A horny wife who exposes her sensitive big tits and big butt, accepts other sticks an

  • amateur censoredbig titsmarried womanluxuluxu-1427luxu1427259luxu-1427
    • 2021-07-06
    39 min

    Pacopacomama 070621_499 Showing Off Sexuality and Being Provocative! : Professional Technique Reika KudoRyoko AsamiyaRie Mukai

  • amateur uncensoredpacopacomama
    • 2021-08-01
    247 min

    [ZMAR-046]All! Airi Natsume

  • natsume atago censoredcreampiesquirtingZMARplanet plusmaruttoZMAR-046ZMAR046h-237zmar00046
    • 2021-08-06
    15 min

    FC2PPV 1949687 [4k] Blow Horse Female College Student’S Rich Pacifier Swallowing Cum Swallow Personal Shooting Limited Deletion Schedule

  • amateur uncensoredfc2
    • 2021-08-13
    119 min

    [JYMA-013]A Perverted Wife With 2 Fetishes. Colossal Tits Ass Bitch M-Slut Celebrity Wife. The Quarter Housewife With J Cup Titties And Extreme Ass.

  • censoredcreampiebig titsJYMAtsukuzuku onna wa tsurai yobuddha dgroupJYMA-013JYMA013jyma00013
    • 2021-09-02
    101 min

    [AKDL-136]A S*****t"s Guardian Tells Me "Today Is My Safe Day" And When We Meet I Give Her Creampies Over And Over Tsukasa Nagano

  • tsukasa nagano censoredcreampiemarried womanAKDLaquinoriaquinoriaknrAKDL-136AKDL1361akdl00136
    • 2021-09-09
    239 min

    [SVDVD-875]The Magic Mirror Number Bus Hard Boiled You Wanted To Go Picking Up Girls, So This Is What You Said To This Real-Life Nurse, "I"m An Intern At Your Hospital, And I Would Like For You To Be A Test Subject For This Cutting-Edge Medic

  • censoredanalcreampieSVDVDsadistic villagekindaichishougo roumagic mirror sadistic villageSVDVD-875SVDVD8751svdvd00875
    • 2021-09-29
    42 min

    491TKWA-193 Geki Kawa K-Cos 3P Creampie & Facial Cumshot! (Meru Kusumi)

  • amateur censoredcreampieuniformtkwatkwa-193tkwa193491tkwa-193
    • 2021-10-16
    119 min

    [MRSS-123]A Rational Wife That Never Yielded To Power, Has Submitted To A Rotten Neighborhood Association Hana Himesaki

  • himesaki hana censoredcreampiebig titsMRSSmisesu no sugao emanuelyumesaki ichiroumisesu no sugaoMRSS-123MRSS123mrss00123
    • 2021-10-21
    17 min

    HEYZO 2637 Kotomi’s Amazing Hand Job – Kotomi Yamasaki

  • amateur uncensoredhandjobheyzo
    • 2021-10-22
    240 min

    [HNDB-202]Quickies Right After Meeting! Instant Orgasms! Fucking Resumes While Her Pussy"s Still Spasming After A Creampie! "I"m Already Coming!" Ignoring Her Resistance, We Keep Fucking And Creampie-ing Her!! 4 Hours Of Continuous Or

  • mitsuki kamiya hill erina censoredcreampiebeautiful girlHNDBbookHNDB-202HNDB202hndb00202
    • 2021-10-23
    241 min

    [SUPA-597]Real - Amateur Creampies, Rare Face Girls Only Deep Creampies 50 Shots Ultimate BEST!

  • censoredcreampiebig titsSUPAclass s amateurtaro kSUPA-597SUPA597supa00597
    • 2021-10-26
    65 min

    500DPL-0048 HIGH END CAR SEX 3 Raw Creampie Debut! Luxury Car Sex To Enjoy With The Finest Beauty Karina Nishida

  • amateur censoredcreampieamateurdpldpl-0048dpl0048500dpl-0048
    • 2021-11-13
    93 min

    300MAAN-716 [H-Cup Big Breasts JD Full Of Motherhood] Kotone-Chan, A Luxury Hostess Who Wants To Drink Together For A Long Time, Appears! Erotic Tech With Plenty Of Capacity Is Superb! !! The Boobs Are Too Big And The Boobs And Boobs Fill Up The Man

  • amateur censoredbig titssquirtingmaanmaan-716maan716300maan-716
    • 2021-11-16
    76 min

    299EWDX-388 G Cup Big Breasts Wife’s Healing Fucking Famous Instrument Ma Co ○ Cum Inside Raw Saddle

  • amateur censoredcreampiebig titsewdxewdx-388ewdx388299ewdx-388
    • 2021-11-18
    105 min

    [AKDL-151]My Sister-in-Law With A Big Ass Is Actually My Longtime Friend - I Gave Her A Creampie While My Brother Was Away - Rion Izumi

  • rion izumi censoredcreampieAKDLaquinoriaquinoriaknrAKDL-151AKDL1511akdl00151
    • 2021-12-04
    120 min

    [GVH-328]A Lewd Housewife Who Comes At Me WIth No Bra Or Pants Has Moved In Next Door! Riona Hirose

  • rio hirose censoredslutsingle workGVHglory questkisakura kabinGVH-328GVH328gvh00328



    • Japan xxx, japanese adult videos, japani sexy, Japanese Adult Movies, JAV censored, Japanese tube, Japanese sex online