wife




FC2HUNTBHODVPPPDMIDVADNNACXNACRJUFEHMNDASDCESDPREDMILKAVSADASDNNPJBLKWANZSHKDROYD

2023-02-11
127 min

BASJ-003 Wife Aoi Yurika Awakens As A Slutty Woman After Being Caught Up With Her Husband'S Ntr Sex Habit

  • yurika censoredcreampieslutBASJbarutanminimal iwamurashukujo no bansanBASJ-003BASJ003basj00003
    • 2023-02-11
    105 min

    ALDN-121 My Mother-In-Law Is So Much Better Than My Wife... Mikako Oshima

  • mikako oshima censoredcreampiesingle workALDNtakara eizoutsukumo kyuutaaleddinALDN-121ALDN121aldn00121
    • 2023-02-11
    123 min

    DVAJ-606 In The Next Room Where My Wife Sleeps, The Silent Staking Piston Asmr In My Ear Makes A Sigh Of Mochi, Mochi Mochi, Whistling, And Laid-Back Piston Sounds Echoing Through The Room, Is It Unbearable Sato'S

  • is it sato momoka kato censoredcreampieslutDVAJalice japank westDVAJ-606DVAJ606dvaj00606
    • 2023-02-11
    120 min

    GMA-040 A Sense Of Guilt And Immorality Towards Her Husband That Preceded Her During A Bondage Training Wife'S Affair. Masochist Widow Sasaki Sasaki Who Falls Into An Adulterer Who Can'T Go Back

  • sakikazu sasaki censoredbdsmsingle workGMAglobal media annexkaiGMA-040GMA040gma00040
    • 2023-02-11
    316 min

    328HMDHX-003 Hamedori Network Mature Woman MAX # 03 [1. Colossal G Cup Plump Mature Wife 55 Years Old] [2. Beauty Sales Manager Of An Advertising Agency 45 Years Old] [3. Slender Beautiful Wife Medical Office 33 Years Old] [4. Trained By A Friend&quo

  • amateur censoredbig titsmarried womanhmdhxhmdhx-003hmdhx003328hmdhx-003
    • 2023-02-11
    119 min

    GMEM-088 Masochistic Wife With Big Breasts Pervert Installation Awakening Sex Doll Fujiwara Kumi

  • fujiwara kumi censoreddeepthroatsingle workGMEMavsbuddha davscollector s goldGMEM-088GMEM088gmem00088
    • 2023-02-11
    150 min

    MDBK-279 From Flirty Love To Creampied Girl Making A Simulated Marriage Experience Wife Agency Delivery

  • yui hatano minami kozue censoredcreampieMDBKk m producek taroubazookaMDBK-279MDBK279mdbk00279
    • 2023-02-11
    115 min

    APNS-306 My Neighbor'S Young Wife Hell Training Her Uterus Is Filled Every Day With Semen Other Than Yours... Minami Sawakita

  • sawakita minami censoredcreampiesingle workAPNSaurora project annexnasu yukihiroAPNS-306APNS306apns00306
    • 2023-02-11
    117 min

    DVAJ-605 A Story About Being Jealous And Clingy By Her Lover Lurking Inside The House, And Having Semen Squeezed Out Over And Over Again At The Last Minute Of Being Caught By My Wife Amiri Saito

  • amiri saito censoredcreampieslutDVAJalice japankirinDVAJ-605DVAJ605dvaj00605
    • 2023-02-11
    99 min

    NSFS-160 Submitted True Story My Wife Was Swapped 21 ~The Tragedy That Attacked A Celebrity Couple~ Ayaka Mutou

  • ayaka muto censoredsingle workdramaNSFSnagae stylenagaeNSFS-160NSFS160nsfs00160
    • 2023-02-11
    322 min

    328HMDSX-003 Hamedori Network Married Woman MAX #03 [1. A Beautiful Wife Who Goes To A Yoga Class, 25 Years Old] [2. A Marshmallow H-cup Newlywed Nursery Teacher, 23 Years Old] [3. A Beautiful Butt Esthetic Married Woman, 28 Years Old] [4. A Beauty C

  • amateur censoredcreampiebig titshmdsxhmdsx-003hmdsx003328hmdsx-003
    • 2023-02-11
    150 min

    NSFS-159 My Boss And My Subordinate Wife 21 ~Humiliating Child-Making Sex With My Geeky Boss~ Kanna Asumi

  • asukami kanna censoredsingle workdramaNSFSnagae styletomitake taroNSFS-159NSFS159nsfs00159
    • 2023-02-11
    119 min

    ALDN-124 A Father Who Loves To Lick And His Frustrated Wife Tsubaki Kato

  • kato camellia kaoru natsuki censoredcreampiesingle workALDNtakara eizouhotate ikkanaleddinALDN-124ALDN124aldn00124
    • 2023-02-10
    165 min

    002HODV-21744 近親NTR 姉妹 夫婦交換 奥井楓 三舩みすず

  • amateur censoredcreampiebig titshodvhodv-21744hodv21744002hodv-21744
    • 2023-02-10
    93 min

    BONY-036 Your Wife Is Covered In Poop, Sakura Miwa

  • sakura mito censoredcreampiesingle workBONYbonita delusional tribehanbaagu sunayamabonita mousouzokuBONY-036BONY036bony00036
    • 2023-02-10
    120 min

    VEO-068 Real Amateur Wife Av Debut! Former Reader Model Brazilian Half Wife Attracts Her Divine Constriction Big Breasts Emiri Kamishima

  • kamishima emiri censoredcreampiesingle workVEOvenuspe tabornVEO-068VEO068veo00068
    • 2023-02-10
    48 min

    FC2PPV 3179707 A Beautiful Wife Who Is In Debt, Sticks Out Her Round And Beautiful Buttocks And Accepts Vaginal Cum Shot.

  • amateur uncensored
    • 2023-02-10
    60 min

    328HMDNC-561 A 42-Year-Old Beautiful Wife Who Can’t Stop Having Sex With Her Brother-In-Law. Private Footage Of Betraying Her Husband And Having Her Young Body Seeded HMDNV-561

  • amateur censoredbig titsmarried womanhmdnchmdnc-561hmdnc561328hmdnc-561
    • 2023-02-10
    240 min

    VENX-197 My Wife'S Sister Suddenly Came Over And Got Overtaken By Her Wife'S Sister, 1 Night 2 Days Highlights 4 Hours 6

  • censoredcreampieVENXvenusincest vi nasuVENX-197VENX197venx00197
    • 2023-02-10
    120 min

    BBAN-408 Daytime Lesbian Intercourse With The Best Mistress. Celebrity Wife Tomomi (31 Years Old) And This (31 Years Old) Edition

  • okanishi tomomi hakuhana censoredBBANbibianwantoppuBBAN-408BBAN408bban00408
    • 2023-02-10
    180 min

    NBES-060 Reprint Thank-You Price 1980 Yen My Wife (32) Was Recently Begged By Her Part-Time Job (20)... → It'S Annoying, So Please Release Av As It Is.

  • censoredNBESjet eizougroupNBES-060NBES060nbes00060
    • 2023-02-10
    35 min

    558KRS-181 A Married Woman In The Prime Of Cheating Now Is The Season With A Sensitive Body 20

  • amateur censoredcreampiemarried womankrskrs-181krs181558krs-181
    • 2023-02-10
    170 min

    HUNTB-475 Three Unknown Couples Are Swingers Living Together Under One Roof! Help Each Other By Sharing Housework Etc! Furthermore, When I Want To Have Sex, I Share My Dick And Pussy And Have Sex At Night

  • censoredcreampieHUNTBhunterkoichi davidsonhhh groupHUNTB-475HUNTB475huntb00475
    • 2023-02-10
    43 min

    FC2PPV 3182401 [Individual Photography / Cheating Addiction] <Big Tits Deca-Ass 40th Wife> Mutsurisukebe Who Is Shy And Shy! Even If You Dress Cool, Your Body Shows An Honest Reaction And Libido Is Fully Open! !

  • amateur uncensored
    • 2023-02-10
    120 min

    NBES-062 Reprint Thank-You Price 1980 Yen Black Interior Ntr My Wife Sakihara Rin Who Did Interior Work With A Jet Black Meat Stick By Black Guy Who Came To Japan Due To Deregulation Related To Immigration

  • sakihara rin censoredcreampiesingle workNBESjet eizougroupNBES-062NBES062nbes00062
    • 2023-02-10
    120 min

    NBES-061 Reprint, Thank-You Price, 1980 Yen, Won The All-Japan Grand Prize, And When I Left It Up To The Clerk'S Wife To Handle Troublesome Customer Complaints, She Was Made To Apologize For Unreasonable Demands, She Was Taken Off, Rubbed, And Pounde

  • haruna hana censoredsingle workNBESjet eizougroupNBES-061NBES061nbes00061
    • 2023-02-10
    120 min

    NKKD-278 The Moment (When) My Wife Turns On The Switch... The Most Sensitive Doorbell (Clitoris) Of Love Continues To Ring Relentlessly By A Technician Acupressure... Haruna Hana

  • haruna hana censoredsingle workNKKDjet eizougroupNKKD-278NKKD278nkkd00278
    • 2023-02-09
    47 min

    FC2PPV 3181461 [Uncensored X Personal Photography] Sorry For Being Awkward For The First Shoot! Exposed Sex On The Balcony Of The House Where The Neighbor’s Wife Has A C***d! If It’s For Money, She’ll Do Whatever She Says… A Dayti

  • amateur uncensored
    • 2023-02-08
    52 min

    FC2PPV 3181395 * Limited Quantity 1930pt → 930pt [F****d / Gonzo] I Was A Young Wife Who Was Disrespecting Repayment, So I Had Her Covered With Semen Inside And Out In 3P.

  • amateur uncensored
    • 2023-02-08
    65 min

    FC2PPV 3181107 [Individual Shooting/Set Sale] A Wife With A C***d Drowning In The Immoral Feeling Of Continuous Vaginal Cum Shot Complete Version

  • amateur uncensored
    • 2023-01-28
    171 min

    TR-2301 An Unfaithful Wife In Her Fifties Wants To Have A Creampied Affair With A Lady Who Wants To Have A Creampied Affair With A Fifty Years Old Unfaithful Wife Who Wants To Have An Unfaithful Wife In Her 50S

  • censoredTRmodestshigeru hagairon plateTR-2301TR2301h-125tr02301
    • 2020-03-15
    140 min

    KAGP-137 13 Blowjobs With Elephant Pants.Pleasant Blowjob That Pulls Out From The Tip Of The Brief And Pulls In The Throat.

  • censoredamateurblowjobKAGPprincess kaguya pt delusional familywife s trapprincess kaguya ptKAGP-137KAGP137kagp00137
    • 2023-02-10
    120 min

    JUQ-168 An Obedient Masochist Wife Who Can'T Reject An Invitation From Her Father-In-Law She Hates So Much, And Is Weak To Push... Mioka Satomi

  • miyoka satomi censoredJUQmadonnaascension shiroJUQ-168JUQ168juq00168
    • 2023-02-09
    172 min

    NHDTB-745 A Countryside Wife In Her 30S Who Had Too Much Sexual Desire At Her Transfer Place To Spoil Her Pussy With A Forcible Ntr Kiss And Eat 3 People A Day

  • censoredcreampieNHDTBnatural highsaruta makotoNHDTB-745NHDTB7451nhdtb00745
    • 2023-02-09
    58 min

    Pacopacomama 020923_793 Fucking a Wife with a Huge Clit Azusa Yamamoto

  • amateur uncensored
    • 2023-02-09
    247 min

    HAWA-289 Cuckolding Verification “I Want To Leave You Beautiful Naked” Memorial Nude Shoot Will The Wife Who Dripped Love Liquid When She Sees Another Model Younger Than Her Husband'S Dripping Love Juice After Seeing Her Wife Have Sex? Vol.15

  • censoredHAWAcosmos videomountain forestcosmospictures soft on demandHAWA-289HAWA2891hawa00289
    • 2023-02-08
    26 min

    FC2PPV 3181075 [Individual] If You Stir The Hole Of The Petite Wife Of De M, It Will Change To Bliss Instead Of Pain.

  • amateur uncensored
    • 2023-02-08
    69 min

    FC2PPV 3181141 ※Limited Quantity For The First Time※[Runaway/Bad Wife] Yoga Instructor (30) Who Came To Recruit Gonzo [cen]

  • amateur uncensored
    • 2023-02-07
    63 min

    Pacopacomama 020723_792 F Cup Slut Wife Kazumi Takahashi

  • amateur uncensored
    • 2023-02-07
    81 min

    INSTMA-055 [Big Breasts Icup Celebrity Wives] Muscles Vs. Celebrity Wives Slime Beautiful Wives With Beautiful Breasts Get Fucked With Muscular Dicks! Private Shot Sex Of An M-Shaped Wife Who Was Completely Creampied By Accepting Uterine Gynecology A

  • censoredINSTMAhamedori.network second editioninstaINSTMA-055INSTMA055h-1472instma00055
    • 2023-02-07
    144 min

    SDNM-370 Ryo Otsuki, 28 Years Old Av Debut, A Simple Wife Raised In Tohoku Who Manages A Small Restaurant With Two Married Couples

  • otsuki ryo censoredcreampiesingle workSDNMsod createkaorureal married woman av experience without telling her husbandSDNM-370SDNM3701sdnm00370
    • 2023-02-07
    77 min

    422ION-0145 One Male Experience, Sexual Development Gonzo Of A G Cup Beautiful Girl Who Only Knows Her Boyfriend

  • amateur censoredcreampiebig titsionion-0145ion0145422ion-0145
    • 2023-02-06
    68 min

    422ION-0144 The Kansai Dialect Made An Erotic Lewd Colleague Married Woman Captivated By My Big Cock!

  • amateur censoredcreampiebig titsionion-0144ion0144422ion-0144
    • 2023-02-06
    115 min

    083PPP-2628 [Netorare] My Wife Was Taken Down By A Masseuse At An Inn-a Husband Who Gets A Full Erection When He Sees His Wife Who Reacts Sensitively While Disliking It

  • amateur censoredcreampiemarried womanpppppp-2628ppp2628083ppp-2628
    • 2023-02-06
    95 min

    HMDNV-373 [Millionaire'S Play] Horny Celebrity Wife, 25 Years Old, 5 Friends With Friends, An Incurable Beauty With Superb Pussies. I Have An Ugly Orgasm With A Nipple Lick And Punch A Piston. Mating In Which Every Sperm Residue Is Squeezed Out Of A

  • censoredHMDNVhamedori.network secondeditionHMDNV-373HMDNV373h-1472hmdnv00373
    • 2023-02-05
    120 min

    FIND-005 A Specialist In Ball Licking!? Slender And Horny Wife Debuts In Her Forties! Tamami 45 Years Old

  • censoredFINDplanet plussakura ninfindFIND-005FIND005h-237find00005
    • 2023-02-05
    120 min

    NACR-630 The Beautiful Wife'S Mistake Onodera Mayu

  • mayu onodera censoredcreampiesingle workNACRplanet plussakura ninshichi ku ryuuNACR-630NACR630h-237nacr00630
    • 2023-02-05
    30 min

    FC2PPV 3179457 [Uncensored / Appearance] It’s A Beautiful Wife With Big Breasts And Big Breasts! Cuckold Sex In Front Of Her Husband! And Vaginal Cum Shot! !

  • amateur uncensored
    • 2023-02-04
    160 min

    SOAN-088 Jealous Of My 8-Year-Old Eldest Daughter, I'M Going To Farm 2 Holes Today... I Think Of My Cuckold Husband And The Real Crazy Amateur Wife Full-Time Housewife Mihina (Pseudonym) 29 Year Old Cuckold Anal Consent

  • censoredSOANyama to soratanizoko fu taroukoumon houmonSOAN-088SOAN088soan00088
    • 2023-02-04
    72 min

    328HMDNC-559 [Magicichi Festival] Crazy Paris Pigal Wife 4P! ! Al Gangi Mari Squirting Rolled Vaginal Cum Shot Buttobi Swapping Party [Hotel Submersion] HMDNV-559

  • amateur censoredcreampiebig titshmdnchmdnc-559hmdnc559328hmdnc-559
    • 2023-02-04
    123 min

    SRMC-051 Hypno-Drama Takeuchi Natsuki, A Young Wife Who Was Raised Full Of Refracted Love And Became Addicted To Hosting

  • natsuki takeuchi censoredsingle workSRMCsaimin rashrassha miyoshiSRMC-051SRMC051srmc00051
    • 2023-02-04
    120 min

    JHEM-005 A Large Gathering Of Horny Wives! “Is It Ok For Your Wife To Have Some Time?” Beautiful Witch Limited Edition Picking Up Girls!! Frustrated Amateur Housewives' Early Afternoon Recording By 4 People 120 Minutes

  • censoredamateurJHEMjukujo honpo emmanuellejukujo honpo jukujo honpo emmanuelleJHEM-005JHEM005jhem00005
    • 2023-02-04
    131 min

    EMBZ-268 Human Marriage Conception Document “Secret” Intrauterine Ejaculation Into A Ripe Wife'S Raw Vagina Hirose Yuka

  • yuka hirose censoredcreampiesingle workEMBZjuku onna juku emmanuellejuku onna jukuEMBZ-268EMBZ268embz00268
    • 2023-02-04
    240 min

    C-2768 Mature Wife Interview Pov Director Takahashi Koichi Special Edited Edition Selection.03

  • censoredCgo go zutakahashi kouichigogos coreC-2768C2768140c02768
    • 2023-02-04
    113 min

    BIJN-237 The Documentation Excessive Sex Excessive Sex With Huge Tirt I Cup Fuck Till Her Consciousness Blows Away Hana Himesaki

  • himesaki hana censoredsingle workBIJNbijin majoBIJN-237BIJN237bijn00237
    • 2023-02-04
    240 min

    XVSR-694 A Wife'S Dirty Secret ~Marital Pleasure~ Hasumi Claire, Son'S Bride ~ Beautiful Wife, Obscene Secret ~ Tomoda Ayaka

  • hasumi claire ayaka tomoda censoredcreampieXVSRmax ak c takedacalenXVSR-694XVSR694xvsr00694



    • Japan xxx, japanese adult videos, japani sexy, Japanese Adult Movies, JAV censored, Japanese tube, Japanese sex online