upskirt schoolgirl miniskirt javcensored jav




FC2AUKGJUFEATIDSTARSMEYDWAAAGVHDTTSPRDHNDAVSAHDKAFSDSSCESDNATRRBDJULMVSDAWDAPOD

2024-04-06
120 min

SLAP-132 Provocation School Girls School Student School Girls Transparent Chair Panmolo Adhesion Panties 15

  • censoredschoolgirlSLAPdigital arcdigital arkSLAP-132SLAP132slap00132
    • 2024-01-13
    104 min

    SLAP-130 A Schoolgirl In A Super Miniskirt Shows Off Her Panties And Provokes Me. (SLAP-130)

  • censoredschoolgirlSLAPdigital arcdigital arkSLAP-130SLAP130slap00130
    • 2023-12-23
    115 min

    SLAP-129 Panchira Co., Ltd. 24

  • censoredschoolgirlSLAPdigital arcdigital arkSLAP-129SLAP129slap00129
    • 2023-09-23
    95 min

    GROO-062 Groovin’ Stripdance Super Miniskirt Schoolgirl 4

  • censoredschoolgirlGROOdigital arcdigital arkGROO-062GROO062groo00062
    • 2023-09-22
    200 min

    HUNTB-573 Nurse"s Room I Went To School And Was Alone With A Girl In The Nurse"s Room! I Am In Agony Every Day Because Of The Girls Who Show Panty Shots And Breasts Without Warning On The Bed In The Infirmary! This Is Not A Place To Study! Su

  • censoredschoolgirlHUNTBhunterkoichi davidsonhhh groupHUNTB-573HUNTB573huntb00573
    • 2023-08-19
    104 min

    SLAP-126 KIGAE Peeping On A Dirty Little Schoolgirl Who Changes Into A Super Miniskirt Uniform

  • censoredschoolgirlSLAPdigital arckashimadigital arkSLAP-126SLAP126slap00126
    • 2023-07-22
    120 min

    SLAP-125 Provocative School Girls Invisibility Transparent Chair Pan Moro Tight Panties 14

  • censoredschoolgirlSLAPdigital arcdigital arkSLAP-125SLAP125slap00125
    • 2023-06-24
    90 min

    SLAP-124 Prison14

  • censoredschoolgirlSLAPdigital arcdigital arkSLAP-124SLAP124slap00124
    • 2023-05-06
    96 min

    SLAP-122 Super Miniskirt School Girls Puri Ass Panty Shot 5

  • censoredschoolgirlSLAPdigital arcdigital arkSLAP-122SLAP122slap00122
    • 2023-03-25
    96 min

    SLAP-118 Kigae Slutty Miniskado Kinky Slutty Woman

  • censoredschoolgirlSLAPdigital arkSLAP-118SLAP118slap00118
    • 2023-03-23
    194 min

    SW-887 I Happened To See A Schoolgirl'S Punch! You'Ve Seen My Underpants, So Be Prepared! I Thought My Life Was Over When I Was Told, But I'M Horny, So Go Have Sex With Me! I Was Invited To Insert My Dick Into A Schoolgirl'S Pussypussy! We Both Had A

  • censoredSWswitchlight fujimaswitch switchSW-887SW8871sw00887
    • 2022-08-06
    98 min

    SLAP-113 パンチラ株式会社22

  • censoredschoolgirlSLAPdigital ark dejitarua kudigital arkSLAP-113SLAP113slap00113
    • 2022-06-25
    95 min

    GROO-060 groovin’ 超ミニスカ女子校生 パンチラDISCO23

  • censoredschoolgirlGROOdigital arkdigital ark dejitarua kuGROO-060GROO060groo00060
    • 2022-01-29
    92 min

    [SLAP-106]KAIDAN 11

  • censoredschoolgirlSLAPdigital arkdigital ark dejitarua kuSLAP-106SLAP106slap00106
    • 2021-12-24
    184 min

    [HUNTB-171]Glasses x Knee-High Socks x Miniskirt x Thong This Sch**lgirl Is So Excessively Erotic, She"s Giving Me A Full-On Hard On! "I Don"t Know If I Can Make You Feel Good, But I Can Do Some Sexy Things For You ..."

  • censoredschoolgirlHUNTBhuntermorikihhh groupHUNTB-171HUNTB171huntb00171
    • 2021-09-09
    167 min

    [SW-799]Looking Down At Girl"s Panties. Just Giving A Sneaky Look To See Her Amazing Panties Even If It Means Getting Caught! She Gets Super Turned On From Getting Checked Out And Now She Wants To Get Lewd!

  • censoredschoolgirlSWswitchraito fuji makotoswitch hibinoSW-799SW7991sw00799
    • 2021-04-09
    145 min

    [SKMJ-158]Slip Your Dick Into This Big Ass Sch**lgirl From Behind For Some Quickie Action! This Beautiful Y********l In Uniform Works Part-Time At A Housecleaning Service And When She Came To Your House You Couldn't Resist The Temptation Of Her M

  • censoredcreampiebig titsSKMJred face girlswing nagaseSKMJ-158SKMJ158h-1324skmj00158
    • 2020-09-05
    53 min

    [HHKL-062]S********l Working Part Time At A Supermarket Still In Her Uniform Innocently Flashes Her Panties And I'm So Horny I Could Explode!

  • censoredschoolgirlHHKLhunterkoichi davidsonhhh groupHHKL-062HHKL062hhkl00062
    • 2020-06-14
    125 min

    [ARM-878]JOI From High S*********ls In White Panties Spreading Their Pussies And Assholes Wide

  • arisaki ichika yumeno misaki censoredanalschoolgirlARMaroma planningmania satoshiaromaARM-878ARM878arm00878
    • 2019-10-03
    320 min

    [HUNTA-662]I'm Super Popular With Girls In Knee-High Socks x Miniskirt Outfits, And I'm Fucking The Shit Out Of Them Too!! I Enrolled Into A New School, Which Was An All Girls School Until Last Year, And Just Turned Coed This Year!! During Ju

  • censoredschoolgirlHUNTAhuntervolvo nakanohhh groupHUNTA-662HUNTA662hunta00662
    • 2019-07-13
    206 min

    [HUNTA-627]Unguarded Panty Shot Action! Is She Doing It On Purpose？ 2 I Work Part-Time At A Convenience Store, And This Sch**lgirl Works There While Wearing Her School Uniform, And Since Her Skirt Is So Short, Whenever She Reaches Up High To Get Some

  • censoreduniformschoolgirlHUNTAhunterkoichi davidsonhhh groupHUNTA-627HUNTA627hunta00627
    • 2019-07-13
    156 min

    [SSNI-520]Total Domain. She'll Constantly Tempt You With Her Beautiful, Slim Thighs. The Bewitching Beauty In Knee-High Socks. Arina Hashimoto

  • there is hashimoto censoredschoolgirlsingle workSSNIs1 no 1 stylemichiru arashiyamaSSNI-520SSNI520ssni00520
    • 2019-06-06
    195 min

    [SW-636]You Like Looking Up Schoolgirl's Skirts, Don't You？ My Adorable Cousins From The Countryside Keep Trying To Seduce Me!

  • censoredSWswitchlight fujimaswitch switchSW-636SW6361sw00636
    • 2019-05-23
    100 min

    [GS-260]I Was Unexpectedly Turned On By The Sight Of This Sch**lgirl In Her Uniform, Standing At The Bookstore And Browsing In Her Short Skirt, So I Found Myself Peeping Some Panty Shot Action. But Seriously, She Didn't Catch On To Me, So I Went

  • censoredcreampieschoolgirlGSsosoru x garconikebukuro store managerGS-260GS2601gs00260
    • 2019-05-23
    215 min

    [SW-632]If You Wanna See A Schoolgirl's Panties, Give Me Money! My Cute Cousins Come To My Place Every Day And Pester Me For Money In Return For Playing With Me And Helping Me Around The House While Flashing Their Panties! They Said They'd Ne

  • censoredSWswitchlight fujimaswitch switchSW-632SW6321sw00632
    • 2018-11-02
    135 min

    [HODV-21334]Full-Booty Panty Shot Show and the Total Domain Between Micro-Miniskirt and Knee-High Stockings The Tiniest, Cutest Classmate Kanon Momojiri

  • momojiri kanon censoredschoolgirlsingle workHODVh m pbottomsHODV-21334HODV2133441hodv021334
    • 2017-12-07
    240 min

    [SW-524]My Classmate Has Some Juicy Looking Thighs, And When I Got A Peek Underneath Her Skirt, I Realized She Was Wearing A Thong! 2 A Schoolgirl In Knee High Socks And A Thong Is Breathing Sweet Nothings Into My Ears

  • censoredschoolgirlSWswitchraito fuji makotoSW-524SW5241sw00524
    • 2017-10-28
    150 min

    [SSNI-036]The Alluring Total Domain Schoolgirl Enjoy Miniskirt, Knee-High Socks, And Flashes Of Bare Legs Arina Hashimoto

  • there is hashimoto censoredschoolgirlsingle workSSNIs1 no 1 stylemonSSNI-036SSNI036ssni00036
    • 2017-10-13
    172 min

    [VRTM-294]We Slipped Some Aphrodisiacs To A Panty Shot Flashing Schoolgirl In A Miniskirt, And She Started Rubbing Her Knee High Socks Together And Wet Her Panties, And Scissor Locked Us In Her Legs And Begged Us To Creampie Her! 3

  • miki aise rina minami censoredcreampieschoolgirlVRTMv r producetiger kosakaiVRTM-294VRTM294h-910vrtm00294
    • 2017-07-06
    167 min

    [SW-494]After This Schoolgirl Kept Flashing Her Panties At Me And I Could No Longer Resist, She Secretly Kept Cumming At Me For Sex, And Since I Had No Other Choice, I Fucked Her

  • censoredschoolgirlslutSWswitchlight fujimaswitch switchSW-494SW4941sw00494
    • 2016-12-22
    450 min

    [SW-454]This Is The Story Of A Schoolgirl Panty Peep Show, And The Girls Who Bashfully Looked Me In The Eye Deluxe Edition

  • censoredschoolgirlSWswitchraito fuji makotoSW-454SW4541sw00454



    • Japan xxx, japanese adult videos, japani sexy, Japanese Adult Movies, JAV censored, Japanese tube, Japanese sex online