this is a little




FC2KSBJAUKGFSDSSHDKACHRVAUKGCESDSANSSNIMVSDMILKATIDMEYDIPXMIDVAVSAHNDAUKSNACXMIDE

2019-07-19
131 min

[TKI-104]Fully Clothed. Tied-Up Slave With Big Tits 03. A Sex Slave Is Turned On By Having Her Big Tits Squeezed And Jiggled

  • rina oumi yuzuki sera censoredbig titssquirtingTKImadmad moonTKI-104TKI104h-286tki00104
    • 2019-07-19
    133 min

    [DKN-010][Perverted Girl] A Curious Girl Who Goes To A Girls' School Is A Perverted Girl Who Wants To Be Creampied.

  • censoredcreampieschoolgirlDKNprestigedockingDKN-010DKN010118dkn00010
    • 2019-07-18
    51 min

    FC2PPV 1127128 [○○ prefecture local idol and 3P vaginal cum shot! ] Seira [3P Creampie Sex Edition] The idol who sings and dances is also a dirty erotic dollar who sings and dances two cocks behind the scenes! [Main story appearance] [With bonus for

  • amateur uncensoredfc2
    • 2019-07-18
    21 min

    FC2PPV 1127038 Every time I want to ejaculate raw, 500 glue is too good I found a gal bitch and immediately inserted a raw peni stick!

  • amateur uncensoredfc2
    • 2019-07-18
    57 min

    FC2PPV 1126670 [Individual shooting] [Nothing] Reiko-san, the pregnancy special again! Of course, the second 8 months pregnant woman sex with continuous pregnancy is also vaginal cum shot! 8 months part 2 ・ Reiko ・ 31 years old ★ Review benefits avai

  • amateur uncensoredfc2
    • 2019-07-18
    185 min

    [CVDX-362]This Mature Woman Is Being Targeted For Her Meaty Hips!! The Bukkake Ass Fucking Molester 3 Hours

  • censoredmature womanbukkakeCVDXcenter villageCVDX-362CVDX362h-086cvdx00362
    • 2019-07-17
    143 min

    [NTRD-076]Cuckolders - A Famous Chef's Wife Is Fucking Around Behind His Back - Sayuki Mogami

  • sayuki mogami censoredmarried womanNTRDtakara videomimasaku shunsleep stealing partyNTRD-076NTRD07618ntrd00076
    • 2019-07-17
    34 min

    FC2PPV 1126189 18-year-old Bangya’s super beautiful breasts shake the first experience cowgirl is super premium! !! Invite to the front row of Serina-chan’s live performance, who came to shoot to chase the band!

  • amateur uncensoredfc2
    • 2019-07-17
    130 min

    [GVG-909]A Full Video Record Of What The Private Tutor Did To His Big Tits Student Nonoka Kawai

  • is it kawai censoredbig titssingle workGVGglory questGVG-909GVG90913gvg00909
    • 2019-07-17
    120 min

    [GVG-907]This Son-In-Law Is Targeting His Mother-In-Law's Excessively Filthy Big Tits Maiko Kashiwagi

  • maiko kashiwagi censoredbig titssingle workGVGglory questkabin kizakuraGVG-907GVG90713gvg00907
    • 2019-07-16
    241 min

    [NITR-459]NITRO Deep And Rich French Kiss Sex Best Hits Collection

  • is it a fountain natsuko mishima censoredcreampieNITRcrystal eizonitroNITR-459NITR45949nitr00459
    • 2019-07-16
    134 min

    [NITR-458]A Big Tits Slut With A Secret Account Is Setting Up An Offline Creampie Fuck Fest With Dirty Old Men IV

  • censoredcreampiebig titsNITRcrystal picturebuddha dnitroNITR-458NITR45849nitr00458
    • 2019-07-16
    52 min

    FC2PPV 1126005 ★ First shot appearance ☆ Plump busty married woman Momoko 40 years old ☆ De M temperament metamorphosis ♥ In agony to merciless nipple torture ~ ♥ The drooling rich caress is the best! No questions asked, raw insertion, vaginal cum sh

  • amateur uncensoredfc2
    • 2019-07-16
    126 min

    [MXGS-1110]A Beautiful Married Woman In A Filthy Love Affair Miko Is A Young Wife Who Found Herself Acting In An Adult Video She Just Decided To Be Herself And Started Cumming And Felt So Good, She Screamed, Gomenasai Miko Matsuda

  • meiko matsuda censoredsingle workMXGSmaxingMXGS-1110MXGS1110h-068mxgs01110
    • 2019-07-16
    69 min

    261ARA-396 [Innocent] 21 years old [Beautiful breasts] Hinano-chan is here! The reason for her application to go to college is “I want to have an adventure … ♪” A naive young lady! Show off erotic kisses that are the exact opposite of

  • amateur censoredsquirtingamateuraraara-396ara396261ara-396
    • 2019-07-16
    121 min

    [MXGS-1113]A Beautiful Big Tits Mature Woman Author Falls For A Trap And Is Pissing And Cumming Herself Silly Ayako Otowa

  • fumiko otowa censoredbig titsmature womanMXGSmaxingMXGS-1113MXGS1113h-068mxgs01113
    • 2019-07-15
    188 min

    [WA-406]She Gets Excited When She Is Being Watched! A Self Shots Addicted Horny Married Woman Gets Into Out Of Control Masturbation vol. 2

  • censoredmature womanWAlotusWA-406WA406h-047wa00406
    • 2019-07-14
    119 min

    [TIKB-048]Brain Juice Trip: Baguko Is Into Creampies and Goes Wild When She Comes

  • censoredcreampiebeautiful girlTIKBtikitiki.comerTIKB-048TIKB048tikb00048
    • 2019-07-14
    74 min

    300MAAN-429 Aya ○ is very similar to ○! !! Healing JD Yukina who works in uniform refre! !! Is this still 19 years old？ !! Blow polished with the back op is a serious divine work! !! I can’t be satisfied with my boyfriend’s rough chin, and

  • amateur censoreduniformamateurmaanmaan-429maan429300maan-429
    • 2019-07-14
    132 min

    [SOJU-012]41 Years Old Queen Marika Is A Married Woman Who Runs An S&M Club, And Now She's Getting Her Pride Dragged Through The Mud By Juniors Dominating Seniors And Forced To Awaken Her Inner Maso Bitch LOL Queen Marika (41 Years Old)

  • censoredamateurSOJUmountains and skyshibaku michinariSOJU-012SOJU012soju00012
    • 2019-07-14
    240 min

    [DVDMS-425]This Old Lady From The Neighborhood Is Getting Some Big Quickie Cock In Her Tight Little Ass! 3 When A Handsome Man Seduces Her For Sex With Forced Entry And Pull Out Piston Pumping Trusts, This Beautiful Married Woman Remembers How It Fel

  • censoredamateurDVDMSdeep sswing nagaseDVDMS-425DVDMS425dvdms00425
    • 2019-07-14
    103 min

    300MIUM-463 Analma ● Ko 2 holes 4 shots Creampie Festival! !! “Anal SEX is not an affair!” The first anal wife in the series! Anal → Ma ● Co → From the infinite cum loop of anal ~ Mass incontinence! Witness the chaotic home SEX where semen

  • amateur censoredanalcreampiemiummium-463mium463300mium-463
    • 2019-07-14
    57 min

    FC2PPV 1124332 [The truth of 19 years old] We will release a limited release of the dark photo opposition that is secretly held in a room where you can see the night view. ww

  • amateur uncensoredfc2
    • 2019-07-14
    52 min

    FC2PPV 1124660 [Personal shooting] Kasumi 31 years old, cuckold 3P edition A slender beautiful wife who is vulnerable to pushing is pierced by another stick in front of her husband and goes beyond frenzy

  • amateur uncensoredfc2
    • 2019-07-14
    33 min

    FC2PPV 1124391 [No / Amateur individual shooting] Embarrassingly private sex! It looks like a completely cabaret-type spoiled cute girl is shy when she points the camera, so take a quick shot! !! I will show you the real erotic! !!

  • amateur uncensoredfc2
    • 2019-07-14
    149 min

    [KTKC-063]#Konomi Is A Hard-Working Lotlita #H-Cup Titties #A Private Video Shoot #Adult Video Leaks

  • censoredcreampiebig titsKTKCkittyx delusion tribebig titsKTKC-063KTKC063ktkc00063
    • 2019-07-13
    63 min

    300MAAN-428 4th Year Marriage Metamorphosis Beautiful Wife Is Disturbed With Other Sticks In Front Of Her Husband SEX! A desire ant that the couple wants to see together! Cowgirl, standing back, coronation, missionary position, 3 vaginal cum shot �

  • amateur censoredmarried womanamateurmaanmaan-428maan428300maan-428
    • 2019-07-13
    160 min

    [BLK-412][Hook Me Up With A Friend I Can Fuck!] My Fuck Buddy's Real Friend Is The Biggest Slut In Saitama Who Is "Usually Unfriendly But Really Amazing When It Comes To Sex" Creampie Cowgirl Sex With Her Is Incredible! A Black Gal In Uni

  • censoredcreampieschoolgirlBLKkira kirakira kira black galBLK-412BLK412blk00412
    • 2019-07-13
    206 min

    [HUNTA-627]Unguarded Panty Shot Action! Is She Doing It On Purpose？ 2 I Work Part-Time At A Convenience Store, And This Sch**lgirl Works There While Wearing Her School Uniform, And Since Her Skirt Is So Short, Whenever She Reaches Up High To Get Some

  • censoreduniformschoolgirlHUNTAhunterkoichi davidsonhhh groupHUNTA-627HUNTA627hunta00627
    • 2019-07-13
    156 min

    [SSNI-520]Total Domain. She'll Constantly Tempt You With Her Beautiful, Slim Thighs. The Bewitching Beauty In Knee-High Socks. Arina Hashimoto

  • there is hashimoto censoredschoolgirlsingle workSSNIs1 no 1 stylemichiru arashiyamaSSNI-520SSNI520ssni00520
    • 2019-07-13
    105 min

    [MVSD-395]Ms. Sasahara Is A Real Bitch Of A Teacher, And We Hate Her Guts, So We're Going To Make Her Drink All Of Our Semen And Fuck Her Up! Rin Sasahara

  • sakihara rin censoreddeepthroatsingle workMVSDm s video groupMVSD-395MVSD395mvsd00395
    • 2019-07-13
    60 min

    FC2PPV 1123847 Limited to 30! [Personal shooting] Model-class style 19-year-old JD is exhausted ♥ Begging for a cock while cramping with a vibe attached to a slender pussy! With the first seeding in my life, my 172 cm body collapses and smiles! [Sale

  • amateur uncensoredfc2
    • 2019-07-12
    57 min

    FC2PPV 1123178 Original personal photography ♥ A certain department store apparel shop manager ♥ Maki (26 years old) promoted from a clerk to a store manager! Sensitivity is also UP! , ・ Continuous live video ♥ There is a bonus video

  • amateur uncensoredfc2
    • 2019-07-12
    24 min

    FC2PPV 1122990 ★ Popular ☆ Miki, a beautiful breast milk mom, is disturbed off-paco (Part 1) ☆ Raw squirrel orgy that immerses her in a big dick! Excited to faint in agony with continuous injection of a large amount of semen ♥ [Personal shooting] * W

  • amateur uncensoredfc2
    • 2019-07-12
    115 min

    [PARATHD-2641]The Truth Is, There Are A Lot Of Beautiful Female Truck Drivers Out There, And We Made Them Cum Their Brains Out With A Sensual Massage In This Deluxe Edition (1)

  • censoredPARATHDparadise tvPARATHD-2641PARATHD2641parathd02641
    • 2019-07-12
    28 min

    [TG-030][A Private Video Session] Yuka Is Working A Side Hustle Blowjob After School And Using Her Ultra Tight Muscular Pussy Too (21)

  • censoredblowjobTG1059 tokyoTG-030TG030h-1304tg00030
    • 2019-07-12
    134 min

    [SCB-001][A Private Video Session] Normally For Some Hotel Play The Price Is 25K for Sex With A Rubber, But We're Offering A Discount For LJK (In The Art Department) Because She's My Free Pussy And I'm Going To Treat You All To Some Free

  • akari kanno censoredbdsmsingle workSCBprestigestrawberry cats goldSCB-001SCB001scb00001
    • 2019-07-12
    225 min

    [SCPX-364]I'm A Cherry Boy, And My Childhood Friend Is A Virgin, And We're Bashfully About To Practice Having Sex! I Promised Only To Rub My Cock Against Her Clit, But Then Her Pussy Got Dripping Wet, And My Dick Just Slipped Right In! As Soo

  • censoredcreampieschoolgirlSCPXscoopyosukemousouzokuSCPX-364SCPX364h-565scpx00364
    • 2019-07-12
    69 min

    300NTK-203 Black Gal Reverse Nan Man Eating! !! Existence is too erotic Black gal Guigui desire bare drunk SEX! !! If you decide on a rich caress from the reverse pick-up and get an erection, you don’t need rubber! !! Creampie Yoyu’s mood b

  • amateur censoredcreampieamateurntkntk-203ntk203300ntk-203
    • 2019-07-12
    151 min

    [SCOP-638]This Neighborhood Elder Sister Is An Exhibitionist Who Likes To Prance Around Her Room Scantily Clad, And I Can See Her Titties Peeking Out From The Side Of Her Shirt, And It's Too Much For Me To Handle! I Tried To Control My Excitement

  • censoredcreampiebig titsSCOPscoopk taromousouzokuSCOP-638SCOP638h-565scop00638
    • 2019-07-12
    46 min

    FC2PPV 1122995 ★ Popular ☆ Miki, a beautiful breast milk mom, is disturbed off-paco (Part 2) ☆ Raw squirrel orgy that gets into big cock! Excited to faint in agony with continuous injection of a large amount of semen ♥ [Personal shooting] * With high

  • amateur uncensoredfc2
    • 2019-07-12
    140 min

    [GRCH-314]A Little Devil Handsome Man Pet Who Is Good At Begging - At First I Thought He Was A Soothing And Good Little Doggie, But At Night, He Transforms Into A Carnivorous And Lusty Wolf - Hibiki Otsuki

  • otsuki sound alex censoredsingle workdramaGRCHgirl s chhiroko sabueGRCH-314GRCH3141grch00314
    • 2019-07-11
    81 min

    200GANA-2117 Seriously Nampa, first shot. 1371 A natural girl who is deceived by a quiz and gets a grip on her life! I was surprised and confused, but I just glanced at the big cock! SEX is rolled up and swept away by a pick-up teacher who does not m

  • amateur censoredsquirtingamateurganagana-2117gana2117200gana-2117
    • 2019-07-11
    137 min

    [RCTD-243]This Big Tits Mama Is Wearing A Bandage Bikini And Committing Naughty Acts At The Pool

  • censoredcreampiebig titsRCTDrocketroute yamazakiRCTD-243RCTD2431rctd00243
    • 2019-07-11
    125 min

    [GS-271]It's Raining Outside, And The Tournament Is Coming Up Soon, So The Girls Stayed Late After Practice To Keep On Training. I Could See Their Track & Field Racing Bloomers Digging Into Their Asses And Their Nipples Poking Out Because They

  • censoredcreampieGSsosoru x garconspada ikebukuroGS-271GS2711gs00271
    • 2019-07-11
    130 min

    [SPRD-1165]This World Is Made For Men And Women Only A Father-In-Law Who Loves To Lick, And A Horny Daughter-In-Law Nao Yuki

  • naoki yuuki censoredsingle workSPRDtakara eizoshigeru kuromatsualeddinSPRD-1165SPRD116518sprd01165
    • 2019-07-11
    108 min

    [SPRD-1164]My Stepmom Is Hotter Than My Wife... Reiko Tozawa

  • yoshiko tozawa censoredcreampiemature womanSPRDtakara eizokyuta tukumoaleddinSPRD-1164SPRD116418sprd01164
    • 2019-07-11
    89 min

    [KAAD-039]My Mother-In-Law Is Hot Kozue Tokita

  • kozue tokita censoredcreampiemature womanKAADcenter villagekotaro misatohona zonoKAAD-039KAAD039h-086kaad00039
    • 2019-07-11
    201 min

    [SDAB-100]This Girl Is Right In The Middle Of Her Adolescence! Rei Kuruki An SOD Exclusive Adult Video Debut

  • satoshi kuruki censoredbeautiful girlsingle workSDABsod createhajime yanaione s youthSDAB-100SDAB1001sdab00100
    • 2019-07-11
    130 min

    [GS-270]Since Both My Wife And I Work, Our House Is Always A Mess, And So I Ordered A Housecleaning Service To Clean Things Up, And This Unbelievably Cute Maid Came To My Home!! And She Was Wearing A Skirt With No Bra On, And I Could See Her Nipples

  • censoredGSsosoru x garcontumblerGS-270GS2701gs00270
    • 2019-07-11
    121 min

    [FAA-315]The Bath Is So Crowded With My Wife's Friends, I Can't Even Breathe... 315

  • censoredFAAf aFAA-315FAA3151faa00315
    • 2019-07-11
    124 min

    [SILK-117]The Cherry Affair - The Truth Is, I'm A xx! -

  • chiaki uehara blue censoreddramaSILKsilk labokinoSILK-117SILK1171silk00117
    • 2019-07-11
    124 min

    [SDJS-027]"This Employee Is A Bigger Pushover Than Any Female Employee In History" A First-Year Staffer Hired Mid-Year To The PR Department Asumi Yoshioka (26 Years Old) She's So Nice, She Can't Turn Down A Request, So We Got On Our H

  • yoshioka asuka censoredsingle workSDJSsod createshuto hoshisod female employeeSDJS-027SDJS0271sdjs00027
    • 2019-07-10
    76 min

    FC2PPV 1121601 [No / Amateur Individual Shooting] Picking Up Girls Takeaway! The super-sensitive plump erotic body of a cute and quiet daughter’s yogari rampage is unbearable! Creampie sex with a sensitive girl who seems to be crazy with just a

  • amateur uncensoredfc2
    • 2019-07-10
    192 min

    [HEZ-064]This Is Some Serious Shit! A Fucking Fight At A Married Women Joint Party!! A Horny Married Woman Nurse

  • censoredamateurnurseHEZhot entertainmentkazuki enenHEZ-064HEZ06459hez00064
    • 2019-07-10
    59 min

    FC2PPV 1121607 [Personal shooting] Model-class style 19-year-old JD is exhausted ♥ Begging for a cock while cramping with a vibe attached to a slender pussy! With the first seeding in my life, my 172 cm body collapses and smiles! [Sales approved]

  • amateur uncensoredfc2



    • Japan xxx, japanese adult videos, japani sexy, Japanese Adult Movies, JAV censored, Japanese tube, Japanese sex online