slut jav creampie slender def




FC2BLKKBIAWDSDABIPXMEYDNACXROYDMIAADTTCHRVSQTEMIDVHDKASPRDAPODSTARSHNDMILKNNPJ

2024-04-06
142 min

EKDV-741 The Destination Is A Country Town ... I Was Confused By The Slut Of A Beautiful Woman Who Lives Next To Me And I Was Vaginal Cum Shot Many Times ... Luna Tsukino

  • tsukino luna censoredcreampiesquirtingEKDVcrystal picturepearl rice sakagamie kissEKDV-741EKDV741ekdv00741
    • 2024-03-15
    120 min

    MIAB-138 The Paper Bread Is Likely To Be Cut Off Because It Erects Too Much ... A Tall Big Tits Body And Extreme Costumes Yuma Senu Esta Yuma Sano

  • sano yuma censoredcreampiebig titsMIABmoody scaptain gangwoneveryone s kikatanMIAB-138MIAB138miab00138
    • 2024-01-19
    130 min

    HMN-509 Do You Want To Ejaculate？ ？ Damn, I Won"t Let You Have Sex Unless You Accumulate More And More Sperm! I Was Caught Cheating And My Ejaculation Was Controlled. After Being Teased For A Month As Punishment, The Sex We Had Together Felt So G

  • mitani akari censoredcreampieslutHMNbookthere is alsoHMN-509HMN509hmn00509
    • 2024-01-12
    93 min

    ORECS-096 Memories Of Being Attacked By Beautiful Girls At A Hot Spring Inn Rei Hinako Suzu

  • censoredcreampieschoolgirlORECSmy amateur z second impactORECS-096ORECS096h-1732orecs00096
    • 2024-01-12
    142 min

    ORECS-095 7P Big Orgy In Open Air Bath & 6 Beautiful Girls In Uniform Harem SEX With Full Body Licking

  • censoredcreampiebig titsORECSmy amateur z second impactORECS-095ORECS095h-1732orecs00095
    • 2023-12-20
    86 min

    DOKI-026 Miss Menes, I Thought It Was Just Seduction Through Cloth! ! This？ Are You Going To Have Raw Sex？ ？ Goddess Service With Different Warmth 2

  • naoki yuuki ueto mari censoredcreampieslutDOKInextdokiDOKI-026DOKI026h-1664doki00026
    • 2023-10-07
    142 min

    EKDV-721 [4K] I Was Working Alone In A Rural Town... I Was Seduced By The Superb Technique Of The Divorced Beautiful Woman With An Overactive Sexual Desire Who Lived Next Door, And I Ended Up Creampied Over And Over Again... Mizuki Aime

  • mizuki ai censoredcreampieblowjobEKDVcrystal picturepearl rice sakagamie kissEKDV-721EKDV721ekdv00721
    • 2023-10-07
    142 min

    MADV-540 [4K] Uniform Female Confinement Pet Training Ai Watashinohajimeteha...Mishiranuotoko. Ai Nonose

  • nonose ai censoredcreampiesquirtingMADVcrystal picturemaniac crystalMADV-540MADV540madv00540
    • 2023-08-18
    73 min

    ORECS-034 Slut Cabin Attendant Private Creampie SEX Natsuki-san Who Works For A Major Airline Company

  • censoredcreampieamateurORECSmy amateur z second impactORECS-034ORECS034h-1732orecs00034
    • 2023-06-30
    130 min

    WAAA-277 If I Get Drunk, I"ll Be Able To Get A Classy Busty Mother-in-law Is A Drinking Nasty And A Vulgar Sexual Appeal Until The Morning JULIA

  • julia censoredcreampiebig titsWAAAones factorywanzWAAA-277WAAA277waaa00277
    • 2023-06-16
    120 min

    PRED-493 I Was Tempted By My Boss"s Wife"s Waist Guin Cowgirl And Whispering Dirty Talk And Squeezed My Sperm Many Times (Subordinate) Sora Amakawa

  • tenkawa sora censoredcreampieslutPREDpremiumtrendy yamaguchielegancePRED-493PRED493pred00493
    • 2023-06-10
    150 min

    SCOP-810 [Pure Madness! ？ ] An Incident Occurred In A Housing Complex Where Three Curious Beautiful Girls Live In A Certain Place! ？ Girls Who Are Curious About Adult Bodies Innocently Pull Out Ji Po! ! A Thorough SCOOP Of A Little Devilish Group Rev

  • censoredcreampiebeautiful girlSCOPscoopcomet akaiSCOP-810SCOP810scop00810
    • 2023-05-22
    48 min

    NHDTB-79702 Raw Cum Slut Group 6 Girls ○ Raw SP J ○ Continued To Be Fucked For A Long Time In A Row

  • censoredcreampieschoolgirlNHDTBnatural highsakurai vanillanatufileNHDTB-79702NHDTB797021nhdtb79702
    • 2023-05-18
    112 min

    FVMD-007 7 God Blow Sumire Mizukawa Who Sucks With Her Lips, Obscene Tongue

  • mizukawa violet censoredcreampiebeautiful girlFVMDfave modetokimotoFVMD-007FVMD007h-1668fvmd00007
    • 2023-05-01
    118 min

    MXGS-1225 Himari Kinoshita X Bondage QUEEN

  • hanazawa himari censoredcreampieblowjobMXGSmaxingkaoruMXGS-1225MXGS1225h-068mxgs1225
    • 2023-04-22
    238 min

    NATR-701 Whole! Rieko Hiraoka

  • rieko hiraoka censoredcreampiemature womanNATRnadeshikoNATR-701NATR701natr00701
    • 2023-04-21
    182 min

    HMN-368 When My Girlfriend Was At Home, I Was Invited By A Senior I Used To Like, And When I Got Hard On An Outdoor Date, I Lost The Love Hotel Game And Cummed Over And Over Again. Akari Mitani

  • mitani akari censoredcreampieslutHMNhon nakaHMN-368HMN368hmn00368
    • 2023-04-14
    115 min

    MVSD-542 Her Younger Sister Is A Little Devil Of Ji*pomania, A Monster Girl! Reverse Runaway To Unconscious Chinchilla! Immediate Park Immediate Zubo Semen Vacuum Cowgirl Piston! Ichika Matsumoto

  • ichika matsumoto censoredcreampiebeautiful girlMVSDm 039 s video groupMVSD-542MVSD542mvsd00542
    • 2023-04-07
    43 min

    FTHT-126 [Can I Get A Teacher? Is It Ok To Be A Teacher?] Sexy Private Tutor And Virgin! [“Doing Kyun Is Proof That It Feels Good, Isn'T It?” Is Your Dick Squeaking?] I'M Amazed By The Private Tutor'S Dirty Talk “I'Ll Tell You About Girls Here (My Di

  • censoredcreampiecosplayFTHTfaleno tubeFTHT-126FTHT1261ftht00126
    • 2023-04-06
    145 min

    MIST-397 At Night With Mary Tachibana... Mary Tachibana Enjoys Sex With A Beautiful Woman At A Hotel

  • tachibana mary censoredcreampiebig titsMISTmr michirusaitaMIST-397MIST3971mist00397
    • 2023-03-28
    122 min

    EUMD-008 What Is Infidelity? H-Cup Pervert Layer Tutor Aimi Rika Seduces Her Tejeres' Father With A Sexy Costume And Plays Compression With Her Boobs

  • rumi tadami censoredcreampiebeautiful girlEUMDfave modesmmdEUMD-008EUMD008h-1718eumd00008
    • 2023-02-26
    62 min

    HNHU-048 Mud ● Raw Sex #Absolute Beauty #S Slutty #Middle Age #Cleaningblowingcum #Slenderbody

  • censoredcreampieblowjobHNHUthat s rightHNHU-048HNHU048h-1658hnhu00048
    • 2022-05-13
    300 min

    DVDMS-820 Anal Licking For A Lewd Slut At The Office. Anal Cunnilingus To Bury In While Tasting And Smelling Her Ass, Her Asshole Is Fully Exposed As It Twitches During Sex, This Tall And Slender Beautiful Woman Is Wet And Dripping With Love Juice.

  • hinako mori himari kinoshita himari hanazawa censoredcreampieslutDVDMSdeepsmotofuji peroflavorsDVDMS-820DVDMS820dvdms00820
    • 2022-04-23
    66 min

    CRNX-055 (4K) If You Think It"s Over Just Because You Ejaculated Once, Then You"re In For A Big Mistake ... Rui Negoto

  • onkoto rui censoredcreampieblowjobCRNXcrystal picturecrystal nextCRNX-055CRNX055crnx00055
    • 2022-04-22
    210 min

    CJOD-341 I Get Invited To A Girls-Only Meetup At A Love Hotel For A Night Of Creampie Sex That Lasts Till Morning. Two Seductive Temptresses Surround Me While Giving Me Sweetly Sadistic Dirty Talk While They Get Slutty! Himari Kinoshita, Hinako Mori

  • himari kinoshita himari hanazawa hinako mori censoredcreampieslutCJODslut havennanzaki masakiCJOD-341CJOD341cjod00341
    • 2022-04-15
    255 min

    DVDMS-805 Anal Licking Against The Bristle On This Beautiful Girl"s Asshole. Hairy Anal Cunnilingus To Taste And Smell It While Nuzzling Into It, Her Asshole Twitches With Indecent Pleasure While Fully Exposed During SEX! Slender Temptress Slut W

  • amateur censoredcreampieslutDVDMSmotofuji peroflavorsDVDMS-805DVDMS805dvdms00805
    • 2022-04-01
    180 min

    WAAA-150 Withstand Runa Tsukino"s Amazing Technique And Win A Creampie Fuck!

  • tsukino luna censoredcreampieblowjobWAAAones factorywanzWAAA-150WAAA150waaa00150
    • 2021-01-01
    120 min

    [NACR-385]Tempted By A Sexually Frustrated Son's Wife Satomi Suzuki

  • satomi suzuki censoredcreampieblowjobNACRplanet pluscherryshichidomeNACR-385NACR385h-237nacr00385
    • 2020-07-04
    150 min

    [PRED-246]I'm Living With An Older Girlfriend Who Likes To Tweak My Nipples Until I Cum Aika Yamagishi

  • aika yamagishi censoredcreampieslutPREDpremiumgoemonelegancePRED-246PRED246pred00246
    • 2020-01-19
    120 min

    [HND-779]The Enchanting Tattooed Beauty Who Lives Next Door - My Girlfriend Is Waiting For Me At Home, But My Neighbor Calls Me Into Her Place For Creampie Sex - Sui Mizumori

  • aoi mizumori censoredcreampiebeautiful girlHNDbookconcave styleHND-779HND779hnd00779
    • 2020-01-19
    120 min

    [CJOD-224]A Sweaty, Lusty Slut! I Was Asked To Creampie Fuck An Escaped Convict... 6 Sui Mizumori

  • aoi mizumori censoredcreampieslutCJODslut havenkitorune kawaguchiCJOD-224CJOD224cjod00224
    • 2019-11-10
    138 min

    [DVAJ-422]My Cousin Always Like To Prance Around Without Her Bra On, And When She Caught Me Peeping On Her While She Was Taking A Bath, She Lectured Me And Made Me To Ejaculate Until My Balls Went Dry Nanami Kawakami

  • kawakami nanami censoredcreampieslutDVAJalice japanviva gonzoDVAJ-422DVAJ422dvaj00422
    • 2019-07-20
    120 min

    [HND-700]This Intellectual Elder Sister Is Getting An Apologetic Ejaculation! I Kept On Apologizing, Over And Over Again, So That I Could Creampie Her. Amy Fukada

  • emi fukada censoredcreampiebeautiful girlHNDbookrusher miyoshiHND-700HND700hnd00700
    • 2019-06-08
    152 min

    [IPX-325]Slut's Amazing Forced Cumshot Technique Takes Men's Breath Away 19 Cumshot Special Jessica Kizaki

  • jessica kizaki censoredcreampiesquirtingIPXidea pocketk westtissueIPX-325IPX325ipx00325
    • 2019-03-10
    177 min

    [IPX-284]Rock Hard Nipples! Miss Yume's Bareback Lesson Full Of Temptation & Punishment Yume Nishimiya

  • yume nishinomiya censoredcreampieslutIPXidea pocketmaeda countachtissueIPX-284IPX284ipx00284
    • 2018-09-22
    159 min

    [HND-572]External G-Spot Sensual Development Orgasmic Uterus Handjob Creampie Slut Akari Mitani

  • mitani akari censoredcreampiebeautiful girlHNDbookrusher miyoshiHND-572HND572hnd00572
    • 2018-09-22
    197 min

    [CJOD-160]Total Domain Nympho Harem Forced To Creampie Held Down By Her Beautiful Legs!!

  • otsuki sound shinoda yu censoredcreampieslutCJODslut havennanzaki masakiCJOD-160CJOD160cjod00160
    • 2018-09-16
    113 min

    [TIKM-008](Palace Visit From a Drunk Slut) Private Video from Nanako Miyamura After She Drunkenly Yearns for a Raw Fuck

  • nanako miyamura censoredcreampieTIKMchikikikikama delusion groupTIKM-008TIKM008tikm00008
    • 2018-09-14
    195 min

    [SCPX-299]I Was Alone With My Big Sister's Slutty Friend She Knew That I Was A Cherry Boy, So She Asked Me, "Do You Want To Have Sex With Me？" And Lured Me To Temptation She Was The School Slut Who Was Famous For Fucking All The Other Boy

  • censoredcreampieslutSCPXscoophassySCPX-299SCPX299h-565scpx00299
    • 2018-08-17
    130 min

    [ELEG-046]WifeLife Vol.046 Eriko Kurata Was Born In Showa Year 40 And Now She's Going Cum Crazy She Was 53 At The Time Of Filming Her Three Body Sizes Are, From The Top, 84/60/95 95

  • eriko kurata censoredcreampiemarried womanELEGsex agenteleganteELEG-046ELEG046h-213eleg00046
    • 2018-07-28
    119 min

    [WANZ-776]My Big Sister Was Luring Me To Temptation Behind Our Parents' Back And She Gave Me A Thrilling Creampie Azusa Ichinose

  • satoshi ichinose censoredcreampieslutWANZones factorywanzWANZ-776WANZ776wanz00776
    • 2018-07-01
    123 min

    [NACR-159]The Alcoholic Mademoiselle Next Next Door Sumire Mizukawa

  • mizukawa violet censoredcreampiemarried womanNACRplanet plusbirdman teppeishichidomeNACR-159NACR159h-237nacr00159
    • 2018-05-26
    119 min

    [WANZ-755]The Greatest Blowjob Techniques From A Girl Who Loves To Suck Dick Akari Mitani

  • mitani akari censoredcreampieblowjobWANZones factorywanzWANZ-755WANZ755wanz00755
    • 2018-04-27
    151 min

    [XRW-467]A 180cm Tall Lady In Super Orgasmic Ecstasy! When This Big Lady Attacks, She Even Fucks In Non-Standard Ways Sae Namori

  • even namori censoredcreampieslutXRWreal worksannie nakamurareal real worksXRW-467XRW467172xrw00467
    • 2018-04-21
    165 min

    [HND-510]My Girlfriend Is Really Close By But She Keeps Whispering Seductive Secrets To Lure Me To Creampie Temptation Akari Mitani

  • mitani akari censoredcreampieslutHNDbooknanzaki masakiHND-510HND510hnd00510
    • 2018-04-21
    145 min

    [HND-509]A Celibate Woman x An Orgasmic Man In Raw Sexual Awakenings! A Basic Instinct Baring Genuine Creampie Unleashing!! Misaki Honda

  • honda cape censoredcreampiebig titsHNDbookhiroharu osakiHND-509HND509hnd00509
    • 2018-03-31
    149 min

    [HND-499]I Was Loved Too Much By My Girlfriend's Little Sister A Secret Creampie Sex Life Ai Hoshina

  • sena ai censoredbeautiful girlslutHNDbookusapyonHND-499HND499hnd00499
    • 2018-01-25
    122 min

    [SIS-079]The Opening Of A Sex Club!？ My Big Sister Is Opening A Sex Club At Our House! And Her Best Customer Is Her Little Brother, Me, Every Day! Aki Sasaki

  • aki sasaki censoredcreampieslutSISgrayssisterSIS-079SIS07912sis00079
    • 2017-09-14
    116 min

    [HND-427]My Big Sister Is Begging Me For Too Much Creampie Sex, And It's Really Starting To Bug Me Shino Aoi

  • megumi shino censoredcreampieslutHNDbookthis is taroHND-427HND427hnd00427
    • 2017-08-18
    122 min

    [TIKF-012]A Miraculously Beautiful Married Woman Slut! This Newlywed Wife Is Fed Aphrodisiacs And Banging Other Men's Cocks

  • censoredcreampieTIKFchikikikikama delusion groupTIKF-012TIKF012tikf00012
    • 2017-07-29
    120 min

    [MEYD-285]Sending Out the Beastly Wives! Ecstatic Temptation of Filthy Perverts Leads to Creampie Sex Miho Tono

  • miho tsuno censoredcreampiemarried womanMEYDtameike goroomura universityMEYD-285MEYD285meyd00285
    • 2017-07-29
    146 min

    [MEYD-284]A Horny Stepmom Fucks Her Son When They're Alone Together She Gets Horny For Animalistic Sex Rino Kirishima

  • rino kirishima censoredcreampieslutMEYDtameike goroomura universityMEYD-284MEYD284meyd00284
    • 2017-05-04
    121 min

    [UD-760]Creampie Wishes My Wife's Friend 2

  • censoredcreampieslutUDleodragon nishikawaUD-760UD760
    • 2012-09-28
    129 min

    [HMN-001]Are You Serious!？ You Can Cum Using Just Your Nipples!？ A Tweaking, Twisting, No-Hands, Out-Of-Control Nipple Orgasm! This Slutty Nipple-Tweaking Elder Sister Type Babe Won't Give You Any Time To Rest After Ejaculating Because She'll

  • ai junsai censoredcreampieslutHMNhypnosis research institutehypnotic apartmentHMN-001HMN001h-443hmn00001



    • Japan xxx, japanese adult videos, japani sexy, Japanese Adult Movies, JAV censored, Japanese tube, Japanese sex online