premium best




FC2MIDVPREDNATRCESDMARAWAAAHMNSHKDLULUAPODVENUGMEMNACXMIDERBDABWSANBBANADNKSBJ

2018-12-21
228 min

[DOCP-113]This Beautiful Married Woman Was Sleeping With Two Of Her Husband's Junior Associates On Each Side Of Her, Who Were Tweaking Her Nipples Until She Got Hot And Horny And Agreed To Have Threesome Sex

  • maria serizawa yu tomita censoredDOCPprestigedoc premiumDOCP-113DOCP113118docp00113
    • 2018-12-21
    245 min

    [DOCP-112]The Sexy Woman With A Beautiful Ass Shows Off Her Butt Bra And Seduces Me

  • yu tomita maria serizawa censoredlingerieDOCPprestigedoc premiumDOCP-112DOCP112118docp00112
    • 2018-12-21
    221 min

    [DOCP-114]She Was Suddenly Grabbed From Behind And Tit Grabbed And Although She Resisted She Got Horny And Descended Into The Pleasure Of Ecstasy! This Big Tits Sensual Nipple Beautiful Girl Is Getting Her Titties Groped As She Writhes And Moans In M

  • mai yamamoto arisa hanyu censoredcreampiebig titsDOCPprestigedoc premiumDOCP-114DOCP114118docp00114
    • 2018-12-14
    240 min

    [PRMJ-021]My Friend's Mom ~The Taste Of Ripeness~

  • censoredmature womanmomPRMJpremium mature woman emmanuelllePRMJ-021PRMJ021prmj00021
    • 2018-12-12
    123 min

    [XVSR-438]A MAX-A Exclusive Actress Welcome To The Premium Soapland A Bubble Princess Paradise Ayaka Tomoda

  • ayaka tomoda censoredsingle workXVSRmax ashanty yazawacalenXVSR-438XVSR438xvsr00438
    • 2018-12-07
    229 min

    [DOCP-109]I Was Admiring The Busty Woman In Revealing Clothes On The Veranda When She Beckoned To Me...

  • natsuko mishima hinami yumezaki censoredbig titsslutDOCPprestigedoc premiumDOCP-109DOCP109118docp00109
    • 2018-12-07
    152 min

    [MGMP-038]"Real Man Squirting!!" It Feels Way Better Than Ejaculation

  • maki kyoko mio morishita censoredsquirtingslutMGMPmegamibeautiful goddess premiumMGMP-038MGMP038mgmp00038
    • 2018-12-07
    479 min

    [PPT-068]Ryo Harusaki 8 Hours BEST PRESTIGE PREMIUM TREASURE Vol. 01. All 6 Titles + Unreleased Footage. Take A Look Back On The Career Of Ryo Harusaki In This Collector's Edition!!

  • ryo harusaki censoredsquirtingsingle workPPTprestigeprestige premium treasurePPT-068PPT068118ppt00068
    • 2018-12-07
    219 min

    [DOCP-110]"I Already Came..." My Little Sister Teased Me About Me Still Being A Cherry BoyBy Flashing Her Panties At Me So I Fucked Her Wildly And Made Her Orgasm Over And Over Again!

  • aoi kururugi yuki sahara censoredschoolgirlbeautiful girlDOCPprestigedoc premiumDOCP-110DOCP110118docp00110
    • 2018-12-07
    239 min

    [DOCP-111]"Seriously, Is She An Angel!？" I Was In The Hospital With Broken Bones And Couldn't Enjoy My Usual Masturbation, And Now My Cock Was At Its Limit! When This Beautiful Nurse Saw Me, She Felt It Was Her Mission To Care For Me, And

  • noa suwon nanami yua censorednurseDOCPprestigedoc premiumDOCP-111DOCP111118docp00111
    • 2018-12-06
    119 min

    [PRED-123]Forced Female Hormone Secretion. Massage That Triggers A Trance. Tsubasa Hachino

  • yano tsubasa censoredcreampiebig titsPREDpremiumzampaelegancePRED-123PRED123pred00123
    • 2018-12-06
    119 min

    [PRED-122]A Childhood Friend Who Apparently Had Feelings For Me Found Out I've Been Going To Massage Parlors And She Was Furious. "If You Love Blowjobs So Much, I'll Give You Blowjobs!" She Continued Sucking Me For 24 Hours And Made M

  • shinoda yu censoredbig titsblowjobPREDpremiumsuisei akaielegancePRED-122PRED122pred00122
    • 2018-12-06
    119 min

    [PRED-117]Former Reporter For A Local TV Station Who Is Now A College Girl Makes Her Porn Debut. Yuki Ito

  • yuki ito censoredsingle workPREDpremiumusa pyonelegancePRED-117PRED117pred00117
    • 2018-12-06
    167 min

    [PRED-118]Dripping Wet! A Perverted Golden-Shower Girl! Aika Yamagishi

  • aika yamagishi censoredcreampieslutPREDpremiumnao masakielegancePRED-118PRED118pred00118
    • 2018-12-06
    120 min

    [PRED-120]Private Tutor Cuckolding ~Video Of My First Girlfriend Having Creampie Sex With Her Sleazy, College Student Private Tutor~

  • censoredcreampieuniformPREDpremiummorutsukunelegancePRED-120PRED120pred00120
    • 2018-12-06
    120 min

    [PRED-119]My Big Sister Is An Anchorwoman Who Loves To Bully Me. Yuka Arai

  • yuka arai censoredbeautiful girlsisterPREDpremiumhiromichi hoseelegancePRED-119PRED119pred00119
    • 2018-12-06
    147 min

    [PRED-113]My Sophisticated Female Boss's Stand-In Cosplay Creampie Shoot. Riri Hosho

  • hosei lily censoredcreampiebig titsPREDpremiumtequilia tinoelegancePRED-113PRED113pred00113
    • 2018-12-06
    119 min

    [PRED-121]Raped By A Young, Sweaty, Literary Girl With Big Tits. Sari Kosaka

  • rin kosaka censoredcreampiebig titsPREDpremiumdragon nishikawaelegancePRED-121PRED121pred00121
    • 2018-11-30
    203 min

    [DOCP-108]The Absent-Minded, Downblouse Girl With Beautiful Nipples Gets Turned On By Being Watched! When I Fondle Her Hard Nipples, She Orgasms Repeatedly!!

  • nana takanami sayumi tominaga censoredsquirtingbeautiful girlDOCPprestigedoc premiumDOCP-108DOCP108118docp00108
    • 2018-11-23
    481 min

    [PPT-067]Maria Aine 8 Hours BEST PRESTIGE PREMIUM TREASURE Vol.02 All 6 Videos + Previously Unreleased Footage In A Collector's Edition That Follows The Career Of Maria Aine!!

  • maria aine censoredsquirtingblowjobPPTprestigeprestige premium treasurePPT-067PPT067118ppt00067
    • 2018-11-16
    231 min

    [DOCP-106]My Wife's Daughter Was So Innocent And Sexy That I Couldn't Resist, So I Laid My Hands On Her And Made My Daughter-In-Law Cum Over And Over Again Fucking Family Creampies

  • sena ai kimana kana censoredcreampieDOCPprestigeupdatingdoc premiumDOCP-106DOCP106118docp00106
    • 2018-11-16
    210 min

    [DOCP-107]My Friend's JK Little Sister Was Smiling Devilishly As She Lured Me To Temptation With Panty Shot Action! She Gave Me A Furious Face Ride With Her Musty Panties And Then She Teased Me With A Horny Hot Dogging Session...

  • yui natsuhara suzu yamai censoredschoolgirlbeautiful girlDOCPprestigedoc premiumDOCP-107DOCP107118docp00107
    • 2018-11-16
    196 min

    [DOCP-105]Is She Really Not Wearing A Bra!？ This Tiny Titty Beautiful Staffer Is Working While Her Nipples Are Totally Erect And She Has No Idea, And It's Getting Me Really Excited... 2

  • haruka mai imai censoredDOCPprestigedoc premiumDOCP-105DOCP105118docp00105
    • 2018-11-09
    481 min

    [PPT-066]Shunka Ayami 8 Hours. BEST PRESTIGE PREMIUM TREASURE Vol. 08. All 8 Titles + Never-Before-Seen Footage. This Collector's Edition Takes A Look Back On The Career Of "Ayami Shunka"!!

  • ayami shunka censoredcreampiebig titsPPTprestigeprestige premium treasurePPT-066PPT066118ppt00066
    • 2018-11-03
    148 min

    [PRED-110]The Total Domain Of An Elder Sister In Knee-High Socks Who Is Giving Me The Golden Shower Slut Treatment Yu Asakura

  • yu asakura censoredslutsingle workPREDpremiumk westelegancePRED-110PRED110pred00110
    • 2018-11-03
    147 min

    [PRED-114]A Sensitive Body Hidden Beneath Her Intellect. We Got A Graceful, Working Cabin Attendant To Make Her Porn Debut! Miu Uchimi

  • utsumi miu censoredsquirtingsingle workPREDpremiumelegancePRED-114PRED114pred00114
    • 2018-11-03
    119 min

    [PRED-112]My Cheating Wife Got Creampied By Her Ex-Boyfriend

  • censoredcreampiePREDpremiummorutsukunelegancePRED-112PRED112pred00112
    • 2018-11-03
    119 min

    [PRED-116]The Master Of Relentless Blowjobs. Spent Cocks Recover Instantly! Blowjob-Loving College Girl Stars In A Porno! Eimi Fukada

  • emi fukada censoredcreampieblowjobPREDpremiumcontour styleelegancePRED-116PRED116pred00116
    • 2018-11-03
    165 min

    [PRED-109]A Local TV Announcer Gets Her First Ever Orgasmic Massive Ecstasy Special! Yuka Arai

  • yuka arai censoredsquirtingbeautiful girlPREDpremiumkyoseielegancePRED-109PRED109pred00109
    • 2018-11-03
    120 min

    [PRED-111]A Shameful Parent-Teacher Conference This Horny Dirty Old Dad Is Giving This Teacher A Sweaty, Drooling, Splattering Pregnancy Fetish Gang Bang Good Time Aika Yamagishi

  • aika yamagishi censoredcreampiesingle workPREDpremiumsapporo taroelegancePRED-111PRED111pred00111
    • 2018-11-03
    119 min

    [PRED-115]I Used An Aphrodisiac To Make The Beautiful Girl In My Class Who Was Out Of My League My Horny Fuck Buddy. Nao Jinguji

  • jinguji temple nao censoredcreampiebig titsPREDpremiumtrendy yamaguchielegancePRED-115PRED115pred00115
    • 2018-11-02
    245 min

    [DOCP-103]I Was Watching My Neighbor, Who Is A Beautiful Woman With Big Tits, Getting Changed...

  • natsuko mishima sakura chinami censoredcreampiebig titsDOCPprestigedoc premiumDOCP-103DOCP103118docp00103
    • 2018-11-02
    242 min

    [DOCP-102]"Please Forgive Me, I'll Do Anything..." This Lady Came To Take Care Of My Complaint, But I Didn't Think She Was Sincere, So I Subjected Her To Torture & Rape With My Rock Hard Cock And Made Her Cum And Get On All Fours A

  • takanashi s takarada monami censoredDOCPprestigedoc premiumDOCP-102DOCP102118docp00102
    • 2018-11-02
    245 min

    [DOCP-104]This Prim And Proper Female Teacher Was Tied Up And Put In The Closet To Cum And Be Destroyed... She Was Making A Teacher Home Visit To The Family Of A Raging Dick Student And Became The Victim Of Sexual Harassment. She Kept Trying To Resis

  • noa suwon reika hashimoto censoredcreampieDOCPprestigedoc premiumDOCP-104DOCP104118docp00104
    • 2018-10-26
    240 min

    [YRH-173]Girls Who Want To Get Married x PRESTIGE PREMIUM 03

  • censoredbig titsamateurYRHprestigeyorozu honpoYRH-173YRH173118yrh00173
    • 2018-10-26
    242 min

    [NPV-021]NANPA TV x PRESTIGE PREMIUM 16 A Massive Haul!! 10 Freshly Caught Super Erotic Beauties In A Furious Fuck Fest Feast!!

  • censoredbig titssquirtingNPVprestigenanpa tvNPV-021NPV021118npv00021
    • 2018-10-26
    230 min

    [DOCP-101]"Shit! I Creampied My Sister!!" I Got Turned On By My Little Sister Who Walks Around The House In Revealing Clothes...

  • arisaka miyuki tomomi hoshisaki censoredcreampiesisterDOCPprestigedoc premiumDOCP-101DOCP101118docp00101
    • 2018-10-23
    240 min

    [KTRA-074]Yoshika Futaba PREMIUM Best 4 Hours

  • rika futaba censoredbig titsbeautiful girlKTRAk tribeKTRA-074KTRA074h-094ktra00074
    • 2018-10-19
    249 min

    [DOCP-099]Her Voluptuous Ass Is Tightly Stuck To My Cock!! Every Time She Teasingly Shakes Her Ass, She Can Feel My Cock Get Bigger, And Then She Began To Lure Me To Temptation With Some Sexy Rump Shaking...

  • misaka ria nanami yua censoredslutDOCPprestigedoc premiumDOCP-099DOCP099118docp00099
    • 2018-10-19
    240 min

    [YRH-172]We Visit Your Workplace. X PRESTIGE PREMIUM 04. Honoka (22), An Office Worker At An Electronics Company. Sasano (24), An Obedient Masochist And Real Estate Agent. Shiina (24), A Busty Saleswoman For A Trading Company With An Extremely Masoch

  • censoredbig titsYRHprestigeyorozu honpoYRH-172YRH172118yrh00172
    • 2018-10-19
    243 min

    [DOCP-100]Turned On By Friend's Girlfriend's Sexy Ass & Indecent Panties! I Tied Her Up and Stuck A Massive Vibrator In Her & She Squirted Over & Over Again! 3

  • yurika ichijo mio censoredsquirtingDOCPprestigedoc premiumDOCP-100DOCP100118docp00100
    • 2018-10-12
    220 min

    [DOCP-098]This Prim And Proper Schoolgirl On Her Way Home From School Is Having Her First Ever Pissing Wetting Yourself Experience!？ She's Shamefully Pissing And Wetting Yourself And Feeling Her Passion For Pleasure Suddenly Rise! And Now She

  • censoredcreampiesquirtingDOCPprestigedoc premiumDOCP-098DOCP098118docp00098
    • 2018-10-07
    118 min

    [MGMP-036]Glove Fetishes The Handjob Madam Satin/Leather/Enamel/Rubber

  • yuuri rin hayama censoredsquirtingslutMGMPmegamibeautiful goddess premiumMGMP-036MGMP036mgmp00036
    • 2018-10-06
    150 min

    [PRTD-020]Noa Is A Female Doctor Who Suffers From Frigidity She Was Degraded With G-Spot Developing Sex Positions... Noa Mizuhara

  • noa suwon censoredcreampiesingle workPRTDpremiumkitorune kawaguchithe strong and noble beautiesPRTD-020PRTD020prtd00020
    • 2018-10-06
    118 min

    [PRTD-019]An Investigator Gets Wet With Humiliation ~A Cocksure Elite Investigator Is Forced To Piss Herself~Yu Asakura

  • yu asakura censoredcreampiesquirtingPRTDpremiumkitorune kawaguchithe strong and noble beautiesPRTD-019PRTD019prtd00019
    • 2018-10-06
    150 min

    [PRED-107]I Was Reunited With The Man Who Made All Of My G-Spots Bloom Ami Ayuha

  • ayuha ami censoredcreampiesingle workPREDpremiumtrendy yamaguchielegancePRED-107PRED107pred00107
    • 2018-10-06
    150 min

    [PRED-108]If I Let Him Rape Me, My Family Will Stay Happy. Mari Takasugi

  • mari takasugi censoredbig titssquirtingPREDpremiumtrendy yamaguchielegancePRED-108PRED108pred00108
    • 2018-10-06
    119 min

    [PRED-103]Cuckolded By The Job Hunting Contemporaries Club ~The Ravaging Creampie Footage Of A Womanizer Who Ruined A Mutual Love~

  • censoredcreampiePREDpremiummorutsukunelegancePRED-103PRED103pred00103
    • 2018-10-06
    118 min

    [PRED-106]It Was Supposed To Be An Innocent Massage Practice But I (Younger Brother) Was Raped With Dirty Talk... Yu Shinoda

  • shinoda yu censoredcreampiesingle workPREDpremiumcontour styleelegancePRED-106PRED106pred00106
    • 2018-10-06
    120 min

    [PRED-104]A Young Lady Studying Liberal Arts Will Thoroughly Rape You In The Cowgirl Position. Nao Jinguji

  • jinguji temple nao censoredcreampiebig titsPREDpremiumsapporo taroelegancePRED-104PRED104pred00104
    • 2018-10-06
    119 min

    [PRED-102]A Former Announcer Of A Local Station Sucks Dicks, Balls And Assholes. Blowjob Special. Yuka Arai

  • yuka arai censoredblowjobbeautiful girlPREDpremiumsuisei akaielegancePRED-102PRED102pred00102
    • 2018-10-06
    119 min

    [PRED-105]Horny And Orgasmic Perverted Gentlemen Over The Age Of 40 Only No Matter How Furious They Kiss, No Matter How Cunning Their Cunnilingus, No Matter How Hard They Suck Those Titties, No Matter How Powerful They Thrust, She'll Cum Back Wit

  • rika kakeyama censoredcreampiebig titsPREDpremiumtrendy yamaguchielegancePRED-105PRED105pred00105
    • 2018-10-05
    244 min

    [AFS-038]Picking Up Married Women Creampie At Home x PRESTIGE PREMIUM 4 Sex Deprived Married Women 19 Passionate 240 Defiling Couple's Holy Ground While The Husband's Not At Home!!

  • censoredcreampiedeepthroatAFSprestigeafter serviceAFS-038AFS038118afs00038
    • 2018-10-05
    217 min

    [DOCP-092]This Girl Who Has A Highly Aesthetic Sense And Loves Herself So Much That She Has To Check Herself In The Mirror Every Day Gets Excited By Watching Herself Cum In The Mirror And Pisses Herself With Pleasure

  • ayuha ami hoshikawa rinhana censoredcreampieDOCPprestigedoc premiumDOCP-092DOCP092118docp00092
    • 2018-10-05
    230 min

    [DOCP-097]A Barely Legal Girl With Beautiful Legs Does An After-School "Fixed Vibrator" Photo Shoot! Her Pussy Starts To Get Wet When She's Made To Pose Provocatively In Her Uniform In Front Of The Camera, So We Insert A Massive Vibrator

  • censoredcreampieamateurDOCPprestigedoc premiumDOCP-097DOCP097118docp00097
    • 2018-10-05
    244 min

    [DOCP-096]A Beautiful Married Woman With Big Tits Experiences A Dick-Rubbing Oil Massage In A Tiny Bikini! The Married Woman In Her Provocative Swimsuit Trembles With Pleasure As A Bare Cock Is Rubbed Against Her Body! She Wants The Big Cock And Ends

  • censoredcreampiebig titsDOCPprestigedoc premiumDOCP-096DOCP096118docp00096



    • Japan xxx, japanese adult videos, japani sexy, Japanese Adult Movies, JAV censored, Japanese tube, Japanese sex online