over hours def javcensored jav creampie




FC2KBISANMARASHKDADNNGODONEZAUKGPPPDMEYDDASDHDKAFSDSSGVHDASDBLKSDABSSNIBBANIPX

2020-10-12
54 min

FC2PPV 1531749 [Limited quantity 2980pt → 1980pt] That super famous doujin AV actress volunteers for a massage model ❤️ Rubbing beautiful big tits covered with oil ❤️ Screaming with brain juice in hell that can not be squid ❤️ There is a vaginal cum

  • amateur uncensoredfc2
    • 2020-10-23
    240 min

    [OKAX-672]Broke Bimbo: A Gal In Her School Uniform Is Short Of Money, And Apparently She's Getting By With A Horny After-School Job LOL

  • censoreduniformschoolgirlOKAXk m producedick mandokuokazuOKAX-672OKAX67284okax00672
    • 2020-10-24
    120 min

    [JUL-350]While My Colleagues Went On A 3-Day, 2-Night Company Trip, I Was Ordered To Stay Behind, And I Was Stuck At The Office, With My Favorite Receptionist... Airi Kijima

  • airi kijima censoredmature womansingle workJULmadonnasatsugu koyamaJUL-350JUL350jul00350
    • 2020-10-31
    120 min

    [MIDE-840]High-class G-cup Quickie Maid - Ibuki Aoi

  • aoi ibuki censoredbig titssquirtingMIDEmoodyzoosaki hirokoujimoodyz divaMIDE-840MIDE840mide00840
    • 2020-11-10
    134 min

    [STARS-298]Darling... The Reason Our Family Hotel Is Doing So Well Is Because I Offer Creampie Services To Our Guests Iori Kogawa

  • iori furukawa censoredcreampiesingle workSTARSsod createosamushi sugawarasod starSTARS-298STARS2981stars00298
    • 2020-11-10
    51 min

    FC2PPV 1564750 [New work until November 18th 1980pt → 1500pt] Creampie raw squirrel to a 28-year-old H cup sister with a clitoris about the little finger! !! Everything that is big and exciting is big!

  • amateur uncensoredfc2
    • 2020-11-11
    41 min

    279UTSU-468 Yukasan

  • amateur censoredcreampiebig titsutsuutsu-468utsu468279utsu-468
    • 2020-11-12
    62 min

    [AKDL-063][Backstage Footage] Celebrity Level Cuteness And Colossal G-Cup Tits!! This Slutty Cosplayer Gets Horny When She's Having A Good Time: Ayaka

  • censoredbig titsAKDLaquinoristickaknrAKDL-063AKDL0631akdl00063
    • 2020-11-13
    212 min

    [HJMO-445]Red Light, Green Light - With A Fixed Vibrator 19

  • censoredsquirtingHJMOhajime kikakuhajimeHJMO-445HJMO445hjmo00445
    • 2020-11-20
    206 min

    [ABW-026]Sexual Awakening, Tasting Godly Milk From H-cup Tits: Super Erotic Colossal Tits, Super Masochistic Cumming 3 - Konomi Nagisa

  • nagisa konomi censoredbig titssquirtingABWprestigesamansa tabataabsolutely wonderfulABW-026ABW026118abw00026
    • 2020-11-28
    29 min

    FC2PPV 1586596 [Leaked / Uncensored] Female-only aroma massage 20-year-old fair-skinned beautiful breasts hidden from raw erogenous zone development

  • amateur uncensoredfc2
    • 2020-12-06
    158 min

    [SORA-285]This Maso And Lusty And Aggressive Lolita Little Bitch Is Prepared To Be Shamed And Volunteering For Breaking In Training! (She Wants To Expose Her Pig-Faced Shame) (Deep Reverse Irrumatio) (Big Dick Threesome G*******ging Sex) (Shameful Go

  • chiharu miyazawa censoreddeepthroatsingle workSORAyama to sorausubashisuiSORA-285SORA285sora00285
    • 2020-12-06
    80 min

    200GANA-2396 Seriously Nampa, first shot. 1564 Secure a female college student who told me that she was in trouble (pretending to be the wind) because her bicycle saddle was stolen! As I approached her kindness, I gradually forgave my body …

  • amateur censoredsquirtingamateurganagana-2396gana2396200gana-2396
    • 2020-12-23
    69 min

    FC2PPV 1617348 [First shot] Etch likes chew ❤️❤️ I was able to make a vaginal cum shot with OL and Icharab SEX that exudes eroticism ❤️❤️

  • amateur uncensoredfc2
    • 2020-12-24
    106 min

    [SPRD-1360]It's So Much Better Than My Husband's... Natsumi Takashima

  • natsumi takashima censoredmature womansingle workSPRDtakara eizokyuta tukumoaleddinSPRD-1360SPRD136018sprd01360
    • 2020-12-27
    103 min

    [HONB-199]Saisho de Saigo

  • censoredamateurHONBmercurythe first shibuya special f e headquarHONB-199HONB199h-1133honb00199
    • 2020-12-31
    117 min

    [ADN-287]Hugged So Tight You Can't Breathe - Passionate Adulterous Sex Shihori Kotoi

  • shiori kotoi censoredsingle workdramaADNattackersamazing meatotona no dramaADN-287ADN287adn00287
    • 2021-01-15
    68 min

    [WAS-001]From Now On I'm Giving This Hot Married Slut Creampies. Picking Up Girls For Cheating Sex

  • censoredcreampieWASlotusWAS-001WAS001h-047was00001
    • 2021-01-23
    134 min

    [JKSR-478](Leaked Pictures) A Sch**lgirl Gets Fucked During Team Training Camp Sex/Night Visits/Creeping Threesomes/Baths/Peeping While Changing... And Plenty Of Other Illicit Videos Full Videos 133 Minutes

  • censoredcreampieschoolgirlJKSRbig morkalprink junkyJKSR-478JKSR47857jksr00478
    • 2021-02-05
    122 min

    [UMD-766]Perverted Gynecologist!! 12 A Young Wife Who Doesn't Know Anything Gets A Creampie Instead Of Treatment!!

  • nene tanaka rumi tadami censoredbig titssquirtingUMDleodragon nishikawaUMD-766UMD766125umd00766
    • 2021-02-11
    135 min

    [SW-756]I Like Older Men. My Friend's Little Sister Was Totally My Type, And She Was The Kind Of Sch**lgirl Who Loved To Lure Men To Temptation! She Got Me Hot And Hard With Her Total Domain Of Knee-High Socks, And Tempted Me With Her Sweet Voice

  • kagami sara censoredschoolgirlsingle workSWswitchSW-756SW7561sw00756
    • 2021-02-19
    480 min

    [MBM-269]mpo.jp Presents Nonfiction: The Best Real Amateur Pick Ups (Fun Intimate Fucks Edition) 38 Girls, 8 Hours, Best Collection

  • censoredamateurMBMprestigempo selection.committeembmMBM-269MBM269118mbm00269
    • 2021-02-20
    102 min

    [YSN-539]I Heard That This Apartment Wife With A Big Ass Was Super Horny, So I Visited Her Home And Fucked Her Until She Was Panting And Moaning With Pleasure (LOL) Saya Minami

  • minami saya censoredcreampieamateurYSNnonYSN-539YSN539h-127ysn00539
    • 2021-03-11
    60 min

    FC2PPV 1721970 ☆ First shot ☆ Complete appearance ☆ Ripe dirty mature woman takes a gonzo challenge to eliminate frustration ♥ Self-proclaimed libido monster that can not be helped because it wants to spear ♪

  • amateur uncensoredfc2
    • 2021-03-19
    50 min

    [ETQR-208](Daydream POV Fantasies) Deep And Rich Sex With A Gorgeous Office Lady Narumi

  • censoredcreampieuniformETQRerotic timeETQR-208ETQR208h-1186etqr00208
    • 2021-03-22
    128 min

    [HOMA-103]

  • mahiro ichiki censoredschoolgirlbeautiful girlHOMAh m p doramajo asagiriHOMA-103HOMA103homa00103
    • 2021-03-26
    105 min

    [YSN-544]My Beloved Stepdaughter Has An Extreme Fetish For Male Odors. She Especially Loves To Sniff My Stinky Private Parts, And When I See How Erotic She Looks As She Enjoys Herself, I Know It's Wrong, But I Get Worked Up Into A Full Erection.

  • nene tanaka kanae kawahara censoredbig titsblowjobYSNnonYSN-544YSN544h-127ysn00544
    • 2021-04-23
    160 min

    [JUFE-283]POV Footage Of Male Subs Getting Fucked! Beautiful Young Dual Succubi Tease Guys Until They Squirt! Wan Horikita Marina Saito

  • horikita wan marina saito censoredsquirtingschoolgirlJUFEfitchsamoariJUFE-283JUFE283jufe00283
    • 2021-05-28
    124 min

    [ECB-145]I Love My Teacher So Much I Could Eat Him Up Erina Oka

  • hill erina censoredschoolgirlsingle workECBwaap entertainmentikkyu sencobra warpECB-145ECB1452ecb00145
    • 2021-05-28
    31 min

    359TYVM-160 Cheating Sex In Work Uniform! ？？ Mass seeding of a horny wife working at a department store! !!

  • amateur censoredcreampiemarried womantyvmtyvm-160tyvm160359tyvm-160
    • 2021-06-05
    58 min

    FC2PPV 1854491 ☆ First shot ☆ Complete appearance ☆ Beautiful girl cafe clerk who looks good with black hair short ♥ Serious vaginal cum shot SEX while blushing fair skin body ♥ [Personal shooting]

  • amateur uncensoredfc2
    • 2021-06-11
    140 min

    [EBOD-829]My Girlfriend's Big Tits - I Couldn't Resist The Temptation Of Whispered Dirty Talk From A Knock-Out Babe And Ended Up Giving Her My Creampie. Mina Kitano

  • mina kitano censoredcreampiebig titsEBODe bodyrokusaburo mishimaEBOD-829EBOD829ebod00829
    • 2021-07-16
    12 min

    FC2PPV 1904119 [4k] I Love Semen! Hentai Lori Meychan’S Cum Big Cock Blow Personal Shoot

  • amateur uncensoredfc2
    • 2021-07-17
    54 min

    FC2PPV 1927816 * New Work Over 50 Off [Married Woman Cum Swallowing] C ● While Remembering The Times, Sucking 3 Other Sticks And Swallowing 3 Cum Swallowing

  • amateur uncensoredfc2
    • 2021-07-20
    120 min

    [SPZ-1110]Completely Unexpected! Special Collection Of Hardworking Older Women Who Open Up Their Legs When Asked!

  • censoredcreampieuniformSPZstar paradisestar paradiesSPZ-1110SPZ1110h-254spz01110
    • 2021-08-20
    118 min

    [VNDS-3371]Pulling A Lewd Prank On My Sister-In-Law With A Nice Ass, Starring Satomi Sometani

  • satomi someya censoredamateurmature womanVNDSstar paradisenext11VNDS-3371VNDS3371h-254vnds03371
    • 2021-08-20
    139 min

    [JUL-687]On The 7th Day Of Being Fucked By My Husband"s Boss, I Lost My Mind... Hitomi Honda

  • honda hitomi censoredmature womansingle workJULmadonnakogatake samuraiJUL-687JUL687jul00687
    • 2021-08-24
    60 min

    10musume 082421_01 Slimy Big Breasts In Competitive Swimsuit Rino Kudo

  • amateur uncensored10musume
    • 2021-09-02
    92 min

    [HTHD-190]My Friend"s Mother - Last Chapter - Saki Oishi

  • saki oishi censoredcreampiemature womanHTHDcenter villagemitsusato koutarouhanazono center villageHTHD-190HTHD190h-086hthd00190
    • 2021-09-08
    71 min

    533NNS-003 Miraculous Chubby Beautiful Girl! !! Matching G Cup And Beautiful Woman With High Facial Deviation Value! !! A Photo Session Leaked Safely With Continuous Vaginal Cum Shot! !!

  • amateur censoredcreampiebig titsnnsnns-003nns003533nns-003
    • 2021-09-09
    129 min

    [MEKO-214]"The Old Lady Rental" Service Returns 03 If You Ask This Sexy And Kind Old Lady, She"ll Secretly Let You Have Creampie Sex, And I Seriously Wanted To Fuck Her Again Like Crazy, So I Asked For Second Helpings

  • censoredcreampieamateurMEKOmature woman laboMEKO-214MEKO214h-1160meko00214
    • 2021-09-22
    60 min

    438PVMK-013 Miya

  • amateur censoredbig titsamateurpvmkpvmk-013pvmk013438pvmk-013
    • 2021-09-23
    120 min

    [RCTD-426]Lesbian Snake Lady

  • future sunohara chiharu sakurai censoredlesbiannurseRCTDrocketcentral yamamotoRCTD-426RCTD4261rctd00426
    • 2021-09-24
    125 min

    [HMN-040]A Fresh Face I"m 20 Now ... So I Don"t Want To Be A Virgin Anymore!! I Have No Experience With Men, But I Have So Much Knowledge About Sex, It"s Time I Made My Creampie Adult Video Debut Kotori Chino

  • kotori chino censoredcreampiebig titsHMNhonnakaarashiyama michiruHMN-040HMN040hmn00040
    • 2021-09-24
    36 min

    FC2PPV 2241687 980 Yen! [Exclusive Video Without 4k] 3 Consecutive 4P Vaginal Cum Shot! Fair-Skinned Plump H Cup Huge Breasts Ol Chihiro-Chan Chapter 21 _ Bonus

  • amateur uncensoredfc2
    • 2021-09-25
    96 min

    521MGFX-026 Charismatic Big Tits Married Woman Soap Lady

  • amateur censoredbig titsmarried womanmgfxmgfx-026mgfx026521mgfx-026
    • 2021-09-30
    99 min

    [FERA-128]Can"t Stop Thinking About This Milf I Accidentally Saw Naked... The Day I Got To See A Milf Take All Of Her Clothes Off. Reiko Kobayakawa

  • kobayakawa reiko censoredcreampiemature womanFERAcenter villageminami daichirakuen center villageFERA-128FERA128h-086fera00128
    • 2021-11-12
    119 min

    [PPPD-978]You"ll Get A Sensual Awakening While Tied Up, Until Your Balls Are Drained Dry! (Cock Tip Tweaking, Mandatory Ejaculations, Man Squirting) A Maso Sensual Health Club Where You"ll Be Drained Through Ecstatic Ejaculations Mina Kitano

  • mina kitano censoredbig titssingle workPPPDoppaiPPPD-978PPPD978pppd00978
    • 2021-11-13
    70 min

    355OPCYN-197 Urara (Kanon Urara)

  • amateur censoredcreampieamateuropcynopcyn-197opcyn197355opcyn-197
    • 2021-11-14
    76 min

    300MAAN-717 <"Actually …" Soul Sex How_to Start With Yarichin Input! I’m Super Excited About My Wife Who Is Crazy In Front Of Me! Jealousy-Covered Ntr Fuck Lessons! This Time, A Couple Practice Sex → Yarichin Man Participates Imme

  • amateur censoredcreampiebig titsmaanmaan-717maan717300maan-717
    • 2021-12-03
    129 min

    [SHKD-980]The Man I Hate Who Ravaged Me. I"ll Never Forget How He Moved His Hips...Kana Sasaki

  • natsuna sasaki censoredsingle workdramaSHKDattackerstakuo ohtanishi yoru akuSHKD-980SHKD980shkd00980
    • 2021-12-07
    50 min

    1Pondo 120721_001 Hospitality: Specialist to ejaculate Utaha Tsukishiro Jessica Takizawa Amu Mashiro

  • amateur uncensored1pondo
    • 2021-12-18
    144 min

    [BDA-150]Classroom of Shame: Shaved Female Teacher Iori Nanase

  • iori nanase censoredbdsmsingle workBDAbermuda mousouzokuichikan abashiriBDA-150BDA150bda00150
    • 2022-01-05
    122 min

    [AMBI-148]The Sex Toy Of Her Perverted Stepfather. The Beautiful Y********l in Uniform Whose Relationship With Her Boyfriend Is Disrupted. Miina Konno

  • miina konno censoredcreampiebig titsAMBIplanet plusdirector oanbibarentsuAMBI-148AMBI148h-237ambi00148
    • 2022-01-13
    85 min

    [IENF-196]A Massage Parlor Where They Always Play With Your Nipples 3

  • mizuki yayoi miho tsuno censoredcreampieIENFienergyienfIENF-196IENF1961ienf00196
    • 2022-01-28
    39 min

    FC2PPV 2628185 First Shot! !! Limited Number! [Uncensored] Staying Date With A Kind Beauty Busty Clerk Who Works At A Pet Shop … The First Vaginal Cum Shot In The Sensitive Body Of Fcup That Shakes A Lot! !! (Feature Film)

  • amateur uncensoredfc2



    • Japan xxx, japanese adult videos, japani sexy, Japanese Adult Movies, JAV censored, Japanese tube, Japanese sex online