mmb




FC2ABWCJODPPPDFSDSSROYDCAWDAVSASPRDSTARSGVHMVSDAWDSSNIDASDKSBJNGODNACXHZGDJUFEWAAA

2020-11-19
119 min

[SSNI-919]Beating Off Middle Age: Honor S*****t's Diligent Blowjob Class! She Has It All Figured Out: How To Best Lick The Asshole, Balls And Tip - Yura Kano

  • yura kanno censoredblowjobbeautiful girlSSNIs1 no 1 stylesuisei akaiSSNI-919SSNI919ssni00919
    • 2020-12-06
    61 min

    413INST-076 [5P Orgy / Personal Shooting MAX] Even if two fashionable girls working in a beauty salon are brought into a pick-up room, they will take a messed up 5P orgy Gonzo! Raise the tension to Erokos SEX and continuously vaginal cum shot at infi

  • amateur censoredcreampieamateurinstinst-076inst076413inst-076
    • 2021-01-16
    34 min

    [HHKL-080]Usually, I Never Have Any Sexual Feelings Towards My Little Stepsister, But When I Saw Her For The First Time In Her Team Uniform, Her Bulging Ass Was Just Too Sexy For Me To Resist! Karen Otoha

  • karen otoha censoredbig titssisterHHKLhunterkonjac kanohhh groupHHKL-080HHKL080hhkl00080
    • 2021-01-22
    241 min

    [AMA-068]A Sexual Genius A Shocking Horny Amateur Test Shoot These Real Amateur Babes Are Here Test The Limits Of Their Sexual Talents For The PRESTIGE Label vol. 68

  • censoredbig titsamateurAMAprestigeamateurAMA-068AMA068118ama00068
    • 2021-01-30
    186 min

    [WAAA-027]If You Can Endure Rika Aimi`s Awesome Techniques You Can Have Creampie SEX With Her!

  • rumi tadami censoredcreampiebig titsWAAAwanz factorywanzWAAA-027WAAA027waaa00027
    • 2021-02-07
    110 min

    [VEMA-155]I'm The Homeroom Teacher, And I'm With My Male S*****t, Drooling And Slobbering And Passionately Intertwining Our Tongues While His Parents Are Away During A French Kissing Home Visit Nene Tanaka

  • nene tanaka censoredcreampiebig titsVEMAvenuskaniemegami venusVEMA-155VEMA155vema00155
    • 2021-02-11
    77 min

    300MAAN-624 [Kalipi (Kali People) Girl, not Parisi! !! ] A cosplay bar clerk from Gunma participates in a guarantee drink! Ji Po’s corona attack with a thorough skill trained by him! !! “If everyone makes a squid with potash, put it all the

  • amateur censoredcreampieamateurmaanmaan-624maan624300maan-624
    • 2021-02-11
    191 min

    [HAWA-237]A Cuckold Investigation "I Want To Film My Wife While She's Looking Her Best" If A Video Instructor Is Teaching A Private Camera Lesson And Left Alone With A Big Tits Wife In A Micro Bikini... Will They Have Sex？ vol. 2

  • censoredbig titsHAWAcosmos eizohidemonkcosmospictures soft on demandHAWA-237HAWA2371hawa00237
    • 2021-02-17
    65 min

    FC2PPV 1688037 [Problem work] Time stops from the beginning! Doujin original! All you want to do because it doesn’t move, if the ww time that you’ve been seeding your dreams moves, you’ll be pregnant with the rich sperm of a former vir

  • amateur uncensoredfc2
    • 2021-02-19
    153 min

    [TSF-014]You're A Male College S*****t Who Loves Betting On Horse Races, But When You Wake Up In The Morning, You Find Out That You've Been Transformed Into A Girl (23) A Thorough Investigation "Seriously, I'm A Guy" But She Could

  • todo hayama censoredcreampieuniformTSFkaguyahimept mousouzokugynecomastia reportTSF-014TSF014tsf00014
    • 2021-03-03
    52 min

    432YKMC-052 Miki (22)

  • amateur censoredcreampiebig titsykmcykmc-052ykmc052432ykmc-052
    • 2021-03-11
    119 min

    [FSDSS-185]All Night Sex After Getting Caught In The Rain With My Female Coworker Nene Yoshitaka

  • nine yoshitaka censoredblowjobsingle workFSDSSfalenodragon nishikawafaleno starFSDSS-185FSDSS1851fsdss00185
    • 2021-03-27
    47 min

    H4610 ori1752 Sayaka Arahashi 20years old

  • amateur uncensoredh4610
    • 2021-04-02
    60 min

    FC2PPV 1751915 [Limited to 100 pieces, 1000 off] Everyone’s Tsu ● Ha ~ ♪ Familiar Tsu ● Had ● Serious 20-year-old working with a boogie ❤️ Untreated pubic hair ❤️ Squirting with an electric massager ❤️ First medium Iki ❤️ A simple girl is insert

  • amateur uncensoredfc2
    • 2021-04-05
    82 min

    FC2PPV 1755787 [Thank you for selling out 100 bottles for the first time for 3 hours] Permanent preservation version ❤️ I can not take the next schedule ❤️ A slender and very beautiful young wife ❤️ Complete appearance of determination ❤️ Perfect voi

  • amateur uncensoredfc2
    • 2021-04-08
    119 min

    [NEO-758]I Want To Drown In Spit And Piss Mizuki Yayoi

  • mizuki yayoi censoredslutNEOradixsakuraba nine heart manneo radixNEO-758NEO758433neo00758
    • 2021-04-15
    83 min

    [REBD-550]Momo: Peach-colored First Love/Momo Honda

  • honda peach censoredsingle workREBDrebeccachikara sawamuraREBD-550REBD550h-346rebd00550
    • 2021-04-15
    116 min

    [VENX-027]Step Mother And Step Son Have Sex 2 Seconds After Father Leaves The House Nanao Nakano

  • nanao nakano censoredcreampiebig titsVENXvenussarufakecest winntersVENX-027VENX027venx00027
    • 2021-04-17
    49 min

    H4610 ori1754 Mina Asao 20years old

  • amateur uncensoredh4610
    • 2021-04-21
    35 min

    FC2PPV 1780423 [Uncensored] I got acquainted with her again ♥ I was a quiet child, but I was sloppy with man juice ♥ [Personal shooting]

  • amateur uncensoredfc2
    • 2021-05-01
    188 min

    [HUNTB-006]"It's Embarrassing, So Please Don't Stare At Me ..." My Stepmom Doesn't Look Her Age, And She's Wearing One Of Her Sexy Swimsuits From Her Younger Days To Cum Bathe Me!! My Stepmom Is So Pretty And Always Dedicated

  • censoredcreampiehandjobHUNTBhunterkoichi davidsonhhh groupHUNTB-006HUNTB006huntb00006
    • 2021-05-26

    10musume 052621_01 Secret Pussy Collection: Kaori Yamamoto

  • amateur uncensored10musume
    • 2021-05-27
    169 min

    [MDVHJ-033]"I Can Never Tell My Husband" About How My Father-In-Law Fucked Me... II

  • yuria nanamiya whiten censoredbig titsdramaMDVHJgraffiti japanmovieMDVHJ-033MDVHJ03348mdvhj00033
    • 2021-05-29
    79 min

    200GANA-2494 Seriously Nampa, first shot. 1642 Picking up students who want to become childcare workers! Have them change into baby clothes and play baby! "Ochi ○ Chin is delicious, isn’t it？ 』 Although I was confused by the sudden developme

  • amateur censoredamateurganagana-2494gana2494200gana-2494
    • 2021-06-01
    120 min

    [NACR-425]I Couldn't Control My Lust After Seeing My Widowed Step Mother In Sexy Tight Yoga Clothes Mai Kitagawa

  • mai kitagawa censoredbig titsblowjobNACRplanet plusbito sakurananakuruNACR-425NACR425h-237nacr00425
    • 2021-06-04
    140 min

    [JUL-597]I'm Embarrassed, But I Want To Kiss You Deeply! Married Woman Who Works At A Famous Makeup Company In The Lipstick Development Department Mitsuha Kikuta 42 Years Old Porn Debut!

  • mitsu kikuda censoredmature womansingle workJULmadonnamametaro mamezawaJUL-597JUL597jul00597
    • 2021-06-04
    159 min

    [JUL-604]The Married Office Lady's Upper Thigh Virtuous Wife Is Embarrassed By Being Made To Do Whatever The Department Head Says Aoi Mukai

  • ai mukai censoredmature womansingle workJULmadonnanao masakiJUL-604JUL604jul00604
    • 2021-06-16
    134 min

    [ROYD-060]When I Got My First Girlfriend, We Used This Camera To Film So Many Wonderful Memories ... And Now, I'm Using It To Film My Scary Friend While He Fucks Her ... And All The While, I Have A Melancholy Erection, That Just Won't Stop ..

  • rio matsumoto censoredcreampiesingle workROYDroyalkawajirihhh groupROYD-060ROYD060royd00060
    • 2021-06-24
    53 min

    C0930 ki210624 Taeko Matsukawa 56years old

  • amateur uncensoredc0930
    • 2021-06-29
    130 min

    [SAN-010]A Girl With A Husky Voice For Whom 20 Sex Friends Aren't Enough - Chihaya Uzuki

  • chihaya uzuki censoredcreampieamateurSANmothermother motherSAN-010SAN010h-796san00010
    • 2021-07-01
    120 min

    [NACR-436]I Was Raised By My Father-in-law - Rina Asuka

  • asuka riina censoredcreampiebig titsNACRplanet plussakura ninshichi ku ryuuNACR-436NACR436h-237nacr00436
    • 2021-07-18
    26 min

    FC2PPV 1929022 [Limited Number 600pt Off] Beautiful Woman Immediately Shoots 3 People At The Hotel Without Blowjob (Sometimes Irama) ☆ Technician Ol Mika Vol.3

  • amateur uncensoredblowjobfc2
    • 2021-07-23
    160 min

    [LULU-084]My Emotionally Disturbed Big Tits Lover Loves Me Too Much, So She Moved In Next Door, And She Started Tweaking My Nipples In A Jealous Fit, And Fucked Me Dry, And Ever Since Then, She's Been Making Me Ejaculate, Over And Over Again, Beh

  • arioka miu censoredcreampiebig titsLULUlunaticsvagmanLULU-084LULU084lulu00084
    • 2021-07-24
    62 min

    [DANDAN-007]"I'm An Old Lady, But I Can't Control Myself Anymore ..." I Was At A Men's Massage Parlor That Didn't Allow Any Nookie, But This Sexy Therapist Kept On Luring Me To An Erectile State, So She Offered Me Several Con

  • censoredbig titshandjobDANDANdandytanaka baconDANDAN-007DANDAN0071dandan00007
    • 2021-08-06
    124 min

    [MIAA-482]Training Camp G*******g - Cute Female Manager Takes A Creampie From Every Member Of Her Team Until Her Pussy Gushes Cum Natsu Tojo

  • natsu tojo censoredcreampiedeepthroatMIAAmoodyzdoragon nishikawaminna no kikatanMIAA-482MIAA482miaa00482
    • 2021-08-13
    32 min

    359TYVM-181 Slender Cheating Wife’S Tide! The Bed Is Flooded With The Tide! Enjoy The Sticks Of Others And Have Sex With Vaginal Cum Shot!

  • amateur censoredcreampiemarried womantyvmtyvm-181tyvm181359tyvm-181
    • 2021-08-19
    241 min

    [AKDL-134]I Will Play With Your Nipples-Full Nipple Play! SUPER BEST

  • yui hatano yahashi bridge censoredbig titsbeautiful girlAKDLaquinorifsetaknrAKDL-134AKDL1341akdl00134
    • 2021-09-03
    180 min

    [MIDE-966]First Experience Documented! The Virgin Boy Came, But I Keep On Training Him, Hana Kotone

  • kotoneka censoredbeautiful girlslutMIDEmoodyzoosaki hirokoujimoodyz divaMIDE-966MIDE966mide00966
    • 2021-09-11
    100 min

    [XRL-022]Race Queen Applicant Training Course: Dad"s Interview - Trainer Aoi Nakashiro

  • nakagusuku censoredcosplaysingle workXRLk m producereal real worksXRL-022XRL022xrl00022
    • 2021-09-11
    226 min

    [BAZX-306]Dirty POV Sex With An Admired Coworker vol. 003

  • censoredBAZXk m producetodobazookaBAZX-306BAZX306bazx00306
    • 2021-09-11
    211 min

    [BAZX-305]Full POV x Total Domain: Beautiful Y********l In Knee High Uniform vol. 001

  • censoredbeautiful girlBAZXk m producetodobazookaBAZX-305BAZX305bazx00305
    • 2021-09-20
    120 min

    [SPZ-1115]The Lining Of Her Swimsuit Is Wet! Overflowing With Mature Woman! Sexy Lymph Massage

  • censoredsquirtingamateurSPZstar paradisesuta paradaisuSPZ-1115SPZ1115h-254spz01115
    • 2021-09-26
    31 min

    FC2PPV 2252860 Until Today! Appearance! "# 6" Company Clerk. Thick Contact By Exchanging Saliva. While Letting Me Say "Put It Inside" … ♡ Both Feelings ♡

  • amateur uncensoredfc2
    • 2021-09-30
    141 min

    [AARM-019]This Ex Gal Has Gotten 100 Guys Off In Her Past, Now She Brings Her Amazing Temptress Techniques To Give Full Satisfaction At Home By Opening A Sexy Masochistic Salon. Wakana Asamiya

  • wakana asamiya censoredhandjobsingle workAARMaroma kikakukadowaki shigeoaromaAARM-019AARM019aarm00019
    • 2021-10-01
    245 min

    [ZMAR-050]All Out! Hana Haruna 2

  • haruna hana censoredcreampiebig titsZMARplanet plusmaruttoZMAR-050ZMAR050h-237zmar00050
    • 2021-10-09
    242 min

    [UMSO-417]Nothing But Watching Girls Cleaning The House Naked, 24 Performers, Video Volume 04. Big Tits Maid Edition.

  • reina fujikawa rin shiraishi censoredbig titsUMSOk m produceumanamiUMSO-417UMSO417umso00417
    • 2021-10-24
    66 min

    345SIMM-671 [Big Pie Constricted Body J ○ Who Graduated From Gonzo Virginity] J ○’s Achan Who Has A Double Smile And A Super Cute Smile And Raw Sex Opening! I Usually Have A Calm And Calm Personality, So I Always Feel Embarrassed When I Have Sex

  • amateur censoredcreampiebig titssimmsimm-671simm671345simm-671
    • 2021-10-29
    66 min

    530DG-029 [Voyeurism In The Fitting Room] Stupor Video ＃ 1

  • amateur censoredcreampiebig titsdgdg-029dg029530dg-029
    • 2021-10-30
    131 min

    [MEAT-037]Kaede (29) Is A Beautiful Chubby Woman With Colossal Tits and a Colossal Ass. Rapid Fall From Grace With Face Fuck and Demon Piss!

  • censoredbig titsdeepthroatMEATbig the nikumichi mousozokuMEAT-037MEAT037meat00037
    • 2021-11-06
    120 min

    [NSFS-040]Mature Mother 16. Mother Who Allowed Son-in-law to Touch Her On Request Chisato Shoda

  • shota chisato censoredmature womanmomNSFSnagae styletomitake taroNSFS-040NSFS040nsfs00040
    • 2021-11-12
    92 min

    300MIUM-759 De S Beauty Female Fallen! !! !! [Anal Torture Is Also Good! Genuine De S Girls Bar Clerk! !! !! ] × [E-Cup Of Sensitive Nipples × 9 Life-Like Legs Body! !! ] Although He Looked Down On The Man And Laughed Mockingly, He Was Miserably Fuck

  • amateur censoredamateurmiummium-759mium759300mium-759
    • 2021-11-12
    121 min

    [FOCS-035][Perfect POV] Exhibitionist Date With A Masochist Girl! Loving Sadism Barrage Gets Her Wet and Squirting! Masochist Dirty Talk And Begging For Service! Over And Over And Over... Kuruki Rei

  • satoshi kuruki censoredsquirtingsingle workFOCSabc mousou zokufocusFOCS-035FOCS035focs00035
    • 2021-11-14
    83 min

    SDJ-016 Non-Chan

  • amateur censoredcreampieamateursdjsdj-016sdj016sdj-016
    • 2021-12-09
    181 min

    [DLDSS-042]100発ザーメン搾り獲るまで出られない家からの脱出 友田彩也香

  • ayaka tomoda censoredcreampiesingle workDLDSSdahliayamaguchi memberDLDSS-042DLDSS0421dldss00042
    • 2021-12-09
    115 min

    [STARS-500]「大丈夫？おっぱい揉む？」人懐っこ神乳J〇が好き放題おっぱいを触らせてくれる癒しの密着性交 月乃ひな

  • tsukino hina censoredsoloworkSTARSsod createkazuie toyotaSTARS-500STARS500
    • 2021-12-20
    73 min

    498DDH-054 When I Brought In A Female Entertainer Of The Saba Saba System For Fun, It Was A Ridiculous Lewd Woman! A Gravure Idol Who Hides The Finest Body That Is As Good As A Gravure Idol And Does Not Give A Gap To Po. ＃ 012 (Umi Natsukawa)

  • amateur censoredbig titsamateurddhddh-054ddh054498ddh-054



    • Japan xxx, japanese adult videos, japani sexy, Japanese Adult Movies, JAV censored, Japanese tube, Japanese sex online