million




FC2KSBJROYDDASDNNPJJULHDKAVENXAMBIHZGDAPODAUKGAVSAGMEMSQTECHRVSTARSAWDVEMACJODDASD

2020-09-15
241 min

[PYM-350]Taking Selfies Sensitive Pussy Gets Wet With Lotion! Dripping With Cum Facial While Masturbating

  • censoredPYMprimoPYM-350PYM350h-283pym00350
    • 2020-09-25
    51 min

    FC2PPV 1511000 [No] First shot of Rina-chan, a fluffy little animal girl who is weak against pushing! Even though I haven’t taken the pill, if I’m asked during the etch, I’ll be OK with raw squirrel and vaginal cum shot and I’ll g

  • amateur uncensoredfc2
    • 2020-09-30
    241 min

    [RD-1020]This Mature Woman Is A Man-Eater! Lewd Housewives With Dark Pubic Hair. Top-Quality Mature Wife Selection: 15 People, 4 Hours Treasure Version

  • censoredmature womanRDatena eizouathenaRD-1020RD1020149rd01020
    • 2020-10-04
    134 min

    [MKON-037]My Girlfriend Found Out About My NTR Fetish, And I Don't Know If She Thought It Would Make For A Nice Birthday Present For Me, But She Showed Me A Video Of Herself Getting Creampie Fucked By Some Dirty Old Man I'd Never Seen Before

  • maika hizumi censoredcreampiesingle workMKONkaguyahimept mousouzokuichiro yumisakimikonMKON-037MKON037mkon00037
    • 2020-10-08
    67 min

    FC2PPV 1527417 [First shot] [Appearance] The highest class vaginal pressure pussy ever! ？？ While the bewitching mature woman with the finest slender body trembles the whole body, the trained abdominal muscles float continuously cum ♡ Creampie Tokuno

  • amateur uncensoredfc2
    • 2020-10-12
    218 min

    [NINE-039][170cm+ Only] These Tall, Dominating Girls Are Gigantic Sluts! Finest Flesh Chateaubriand, 5 Girls' Assorted Luxury Set

  • censoredbig titsamateurNINEmercurychateaubriand hutNINE-039NINE039h-1133nine00039
    • 2020-10-20
    61 min

    Caribbeancom 102020-001 My Wife’s SOV With Ex And His Friend Nene Sakura

  • nene sakura uncensoredcreampiecaribbeancom
    • 2020-10-29
    62 min

    336KNB-126 Caress the young wife who is unsatisfied with the rut SEX with her husband. The fascinating whip and nice ass are nailed so that they can be popped with each piston! !! I will take a gonzo with this married woman from now on. 22 at Nanasat

  • amateur censoredmarried womanamateurknbknb-126knb126336knb-126
    • 2020-10-31
    172 min

    240TOKYO-403 Yuha

  • amateur censoredcreampieamateurtokyotokyo-403tokyo403240tokyo-403
    • 2020-11-06
    60 min

    Caribbeancom 110620-001 Dynamite: Hasumi Yoshioka

  • amateur uncensoredcreampiehandjobcaribbeancom
    • 2020-11-06
    119 min

    [JUL-365]Swimming Class NTR Amazed By The Instructor's Kindness, This Married Woman's Shocking Cheating Video! Himari Kinoshita

  • himari kinoshita censoredmature womansingle workJULmadonnarokusaburo mishimaJUL-365JUL365jul00365
    • 2020-11-12
    129 min

    [MEKO-194]Married Woman Who Took A High Paying Part Time Job As A Nude Art Model Fucked And Filled With Cum 29

  • censoredcreampieamateurMEKOmilf laboMEKO-194MEKO194h-1160meko00194
    • 2020-11-16
    109 min

    [MMRAA-173]天羽成美 コスって！恋して！

  • amateur censoredMMRAAMMRAA-173MMRAA173
    • 2020-12-05
    151 min

    [SSNI-934]Uncannily Piss-Flooding Her Pants! She Squirts, Leaks Love Juice, And Pisses Herself Dry Every Ounce Of Pleasure Juice Flushes Out Of Her In Hard-Climax Sex Rena Kodama

  • kodama rena censoredsquirtingbeautiful girlSSNIs1 no 1 stylekyoseiSSNI-934SSNI934ssni00934
    • 2020-12-08
    43 min

    362SCOH-020 [Creampie] Let a carefully selected beautiful girl cosplay and conceive my child! [Ran ● Shiro]

  • amateur censoredcreampiebig titsscohscoh-020scoh020362scoh-020
    • 2020-12-10
    481 min

    [HEZ-227]She's Been Deprived Of Sex, And That's Why She's Overflowing With That Bitchy Smell It's So Naughty Your Erection Will Be Go Beyond All Limits! This Wife Is Oozing With Pheromones 27 Ladies 8 Hours

  • censoredcreampiemarried womanHEZhot entertainmentmarried woman hot entertainmentHEZ-227HEZ22759hez00227
    • 2020-12-11
    250 min

    [MDTM-690]Super Horny Girls from an Elite Girls School Show Us Their True Colors 10

  • kamikawa starry sky red fruit censoredcreampieuniformMDTMuchu kikakutetMDTM-690MDTM690h-585mdtm00690
    • 2020-12-18
    150 min

    [GBSA-065]Wife Resort - 41-Year-Old Arisa

  • censoredmature womanGBSAgogos black mousouzokukoichi takahashigogosGBSA-065GBSA065gbsa00065
    • 2020-12-18
    135 min

    [MMYM-041]This Fine Woman Stared At Me With A Tempting Gaze And Hit Me With A Steady Stream Of Ass-Shaking Filthy Dirty Talk Nanami Matsumoto

  • nana matsumoto censoredbig titsslutMMYMmarrionaida yumenoyumenoMMYM-041MMYM041mmym00041
    • 2020-12-24
    124 min

    [SPRD-1359]Journey: A Stepmom's Trip Alone With Her Stepson - Rieko Hiraoka

  • rieko hiraoka censoredmature womanmomSPRDtakara eizorokusaburo mishimaaleddinSPRD-1359SPRD135918sprd01359
    • 2020-12-30
    113 min

    [RD-1031]Sharing A Room With My Female Boss On A Business Trip, I Got A Hard-On... "Stop It Right Now Or You'll Be Fired!"

  • censoredmarried womanblowjobRDathena videomurayamaathenaRD-1031RD1031149rd01031
    • 2021-01-04
    123 min

    [SHMO-183]Venus Therme / Kanon Chura

  • mira kanon censoredsoloworkSHMOorustak softSHMO-183SHMO183
    • 2021-01-06
    56 min

    FC2PPV 1536542 [Completely original] [Uniform] [Gal] [With benefits] I tried to mischief the gal J ○ playing with Dan Revo!

  • amateur uncensoredfc2
    • 2021-01-17
    104 min

    [VEC-461]All Alone With My Friend's Mother. Made To Have Secret Creampie Sex With A MILF... Kana Morisawa

  • kana morisawa kanako iioka censoredcreampiemature womanVECvenuspetermegami venusVEC-461VEC461vec00461
    • 2021-01-19
    62 min

    HEYZO 2443 Orgasms With A Horny Pussy Girl Vol.11 – Kana Takashima

  • kana takashima uncensoredcreampieheyzo
    • 2021-01-27
    53 min

    374SHOW-045 Ayaka

  • amateur censoredamateurshowshow-045show045374show-045
    • 2021-02-05
    84 min

    [FTHT-008][Overwhelming Climax! Non-Stop Surging Orgasms! Pissing Herself In Face-Fucking Ecstasy!] Sex So Wild Beyond All Limits You Can Only Feel Fear! Brain Orgasm From Repeated Hard Piston Fucking! Pissing From Face-Fucking! ...

  • censoredcreampieFTHTfalenodavielfalenotubeFTHT-008FTHT0081ftht00008
    • 2021-02-19
    142 min

    [KTB-040]The Carnal Office Girl Club 7 - Dispatched From The Office To Satisfy Your Sexual Urges, Miss Misono Will Milk Your Seed - Misono Waka

  • misono waka censoredbig titssingle workKTBkahanshin tigers mousouzokukahanshin tigersKTB-040KTB040ktb00040
    • 2021-02-20
    30 min

    FC2PPV 1695262 20-year-old slender active JD, Hina-san again! Cowgirl creampie sex with Rikusu! I can’t wait to see him endure the pain! [Bonus is a handjob blowjob! ]

  • amateur uncensoredfc2
    • 2021-02-21
    122 min

    [DASD-818]The Golden Shower Domain This Sch**lgirl Was Receiving Breaking In Piss Training By A Teacher With Abnormal Sexual Hangups And Now She's Dribbling Her Holy Waters Down Her Crystal Pure Thighs Mao Watanabe

  • mao watanabe censoredcreampiesquirtingDASDdassDASD-818DASD818dasd00818
    • 2021-03-04
    29 min

    FC2PPV 1711781 Until 11 980 ＃ I started to bring a girl with a nice ass lacking money into the room

  • amateur uncensoredfc2
    • 2021-03-07
    136 min

    [TSF-015]You're A Male Office Worker, But When You Wake Up In The Morning, You've Discovered That You've Become A Woman (20) A Thorough Investigation You Were Bi And Absolutely The Dominant One, But Now You're Cumming Like A Bitch And

  • ao itaba censoredcreampiebeautiful girlTSFkaguyahimept mousouzokugynecomastia reportTSF-015TSF015tsf00015
    • 2021-03-11
    130 min

    [MEKO-206]All-New "The Old-Lady-For-Rent" Service 09 This Housecleaning Service Will Provide Everything, Even Creampie Sex, So I Decided To Make Some Even More Extreme Demands

  • censoredcreampieamateurMEKOmilf laboMEKO-206MEKO206h-1160meko00206
    • 2021-04-14
    179 min

    [SSIS-046]While Your Girlfriend Was Away Her G-Cup Little Sister Seduced You Into Fucking Her All Day Long - 72 Hours Caught On Camera. Mahina Amane

  • amane mahina censoredbig titsslutSSISs1 no 1 stylebungo maedaSSIS-046SSIS046ssis00046
    • 2021-04-14
    204 min

    496SKIV-009 Nao-chan (21)

  • amateur censoredcreampiebig titsskivskiv-009skiv009496skiv-009
    • 2021-04-15
    134 min

    [CMV-153]Priestess With Big Tits Falls Into Rope Bondage Hell Living Sacrifice Wooden Horse Play Ai Shinkawa 7

  • aishin shinkawa censoredcosplaysingle workCMVcinemagicmarukatsuvixenCMV-153CMV153cmv00153
    • 2021-04-24
    42 min

    [OSST-009]We Discovered This Wild And Tanned Gal In South Korea, So We Tried To Domesticate Her With Our Japanese Dicks! We're Soiling Her Tanned Body With Loads And Loads Of Our Semen!

  • censoredbig titsamateurOSSTpatzkin amateurbooker tulchan amateurOSST-009OSST009h-1450osst00009
    • 2021-05-29
    66 min

    H0930 tk0035 Mariko Shinobe 43years old

  • amateur uncensoredh0930
    • 2021-05-29
    92 min

    [VENX-041]My Big Tits Sister-In-Law Is Luring Me To Temptation With Her Titties - I Was Dumped By My Girlfriend, And My Sexy And Kind Big Titty Big Sister-In-Law Was Trying To Cheer Me Up (But The Truth Was That She Was Just Horny Because She Hadn�

  • airi momose censoredcreampiebig titsVENXvenuskaniefakecest winntersVENX-041VENX041venx00041
    • 2021-06-01
    134 min

    [MSFH-062]My Girlfriend Is Older Than Me, And Usually She's An Elder Sister Type Who Is Trustworthy And Reliable, But Whenever We're Alone, She Becomes A Lovestruck Maso Bitch, And We Spent A Sleepover Date Fucking And Loving Our Brains Out A

  • kiyo ami censoredbig titssingle workMSFHsod createzack araims sodMSFH-062MSFH0621msfh00062
    • 2021-06-05
    63 min

    SIRO-4518 [First shot] [Healing beautiful girl JD] [Natural sticky butt] Beautiful girl college student with 100 purity. Although she is shy, she can not resist her pleasure and asks for a meat stick many times while moistening her eyes .. AV applica

  • amateur censoredamateurbeautiful girlsirosiro-4518siro4518siro-4518
    • 2021-06-20
    129 min

    [CEMD-028]Pushed To The Upper Limit Of Nipple Pleasure! Sensitive Teats Teased Relentlessly! Mao Watanabe

  • mao watanabe censoredcreampieblowjobCEMDceleb no tomoCEMD-028CEMD028cemd00028
    • 2021-07-10
    130 min

    [AVSA-172]SUPER FISHEYE FETISHISM Voluptuous Nympho Nurse's Thick Curves Honami Akagi

  • honami akagi censoredbig titssingle workAVSAavs collector sbuddha davscollector sAVSA-172AVSA172avsa00172
    • 2021-07-17
    150 min

    [JUL-660]A Drama Without Dialogue: No Words Needed, This Is The Ultimate Adulterous Sex Where Everything Is Told Through The Eyes And Fingers - Ayaka Mutou

  • ayaka muto censoredmature womansingle workJULmadonnanao masakiJUL-660JUL660jul00660
    • 2021-07-17
    211 min

    [DASD-898]A Woman Genuinely Addicted to Anal Fucking: Filling Up All Holes SP

  • censoredanalbig titsDASDdaskogoro kindaichiDASD-898DASD898dasd00898
    • 2021-08-11
    64 min

    230OREC-845 Meru-San (26 Years Old) 2nd Year Of Marriage

  • amateur censoredcreampiebig titsorecorec-845orec845230orec-845
    • 2021-08-16
    113 min

    FC2PPV 2035855 Complete Appearance ♥ ️ 161/40 Super Slender Fair-Skinned Nude ♥ ️ Neat And Chaste Beautiful Wife Forbidden Ntr Affair Sex ♥ ️ De M Nature Is Exposed In The Shame Play Of The Daytime … ♥ ️ ♥ ️

  • amateur uncensoredfc2
    • 2021-08-31
    183 min

    [SDNM-299]People Think I Can Do Anything But There Are Times Where I Just Want To Be Spoiled Airi Suenaga, 29, AV DEBUT

  • suenaga airi censoredmarried womansoloworkSDNMsod createcompany matsmahonmono hitodzuma dannani naisho de av taikenSDNM-299SDNM299
    • 2021-09-29
    71 min

    494SIKA-111 Gully Small Tits J ○ Without Blow + Nipple Playing Sex

  • amateur censoredcreampieamateursikasika-111sika111494sika-111
    • 2021-10-21
    50 min

    413INST-176 [Married Woman / Orgy Individual Shooting] Big Breasts I Cup ★ Spodim Married Woman Who Trains To A Super Body Like A Model. It Falls Alive By Being Stabbed By A Big Cock Near A Mama Friend. Of Course, Plenty Of Seeding! (Rinne)

  • amateur censoredcreampiebig titsinstinst-176inst176413inst-176
    • 2021-10-22
    150 min

    [CJOD-316]Julia Seduces Me In A Back Alley. Slutty Date Fucking And Hard Creampying Countless Times Until The Morning...

  • julia censoredcreampiebig titsCJODbitorendei yamaguchichijo hebunCJOD-316CJOD316cjod00316
    • 2021-10-29
    98 min

    420HOI-205 Noa (Sasaki Noa)

  • amateur censoredbig titsamateurhoihoi-205hoi205hoi-205
    • 2021-11-09
    80 min

    534IND-009 Rumored Super Popular Jimaru P Active Beautiful Girl And Translated Ali Yen Active Virgin W Manko Continuous Creampie 3p Creampie Video Outflow Ww Satisfaction Half-Satisfaction …

  • amateur censoredcreampiebig titsindind-009ind009534ind-009
    • 2021-12-18
    66 min

    10musume 121821_01 F Cup Boobs Santa Will Serve Your Dick Aki Kawada

  • amateur uncensored10musume
    • 2021-12-29
    55 min

    Pacopacomama 122921_579 Mature Woman Have A Fling With Sex Toy Wearing: Maki Who Got Into The Pleasure Of Remote Control Maki Koizumi

  • amateur uncensoredpacopacomama
    • 2022-01-05
    60 min

    [010522-001]Debut Vol.72: Oh no! My sexual sensitivity keeps increasing!!

  • ai minami uncensoredcreampiehandjobcaribbeancom



    • Japan xxx, japanese adult videos, japani sexy, Japanese Adult Movies, JAV censored, Japanese tube, Japanese sex online