love




FC2SQTEHUNTBJUFEHMNNACXSDABHODVONEZMIDVFSDSSSSNIMIAAVEMASTARSSPRDATIDAWDCHRVNNPJBLK

2020-04-26
122 min

[SQTE-296]What If I Start Up "That Kind" Of Relationship With My Sharehouse Housemate 2 Days Before Saying "Sayonara" And Moving Out？ Mio Ichijo

  • ichijo mio censoredblowjobbeautiful girlSQTEs cuteno directorSQTE-296SQTE296sqte00296
    • 2020-04-25
    239 min

    [YSAD-038]I Love To Be Treated Like One Of Your Sex Toys, Because Even When I Hate It, My Body Loves It. Kotone Toa

  • toua kotone censoredcreampiesingle workYSADkomyono directorYSAD-038YSAD038540ysad00038
    • 2020-04-25
    118 min

    [MIAA-262]Total Domain Love: Beautiful Y********l in Uniform With Knee-high Skirt: Ichika Matsumoto

  • ichika matsumoto censoreduniformbeautiful girlMIAAmoodyzrakudaeveryone s porn starMIAA-262MIAA262miaa00262
    • 2020-04-25
    117 min

    [MIDE-766]I Awoke Alone In A Love Hotel With My Hot Female Boss... I Was Too Out Of It To Move As She Straddled Me, And Until Morning Came, Sucked My Newly Wedded Ass Into A Sticky Web Of Adultery... Minami Hatsukawa

  • hatsukawa minami censoredcreampieblowjobMIDEmoodyzrokusaburo mishimamoodyz divaMIDE-766MIDE766mide00766
    • 2020-04-24
    240 min

    [OKAX-612]Peeping At Inner-City Love Hotels - 13 Couples, 240 Minutes

  • censoredamateurmature womanOKAXk m producedick mandokuokazuOKAX-612OKAX61284okax00612
    • 2020-04-24
    131 min

    FC2PPV 1347278 152/40 Developing Young Girl ○ Body Shape ♥ ️ Lori Lady Girl With A Dazzling Young Smile ○ Raw 18 Years Old ○ Drug Sex First Experience ♥ ️ 2 Hours Or More Dense Raw Etch While Dripping Love Juice From The Vaginal Opening ♥ ️ The Last

  • amateur uncensoredfc2
    • 2020-04-23
    173 min

    [DANDY-710]I Love It Out In The Sticks! Simple And Cute Relaxing Type Girl Comes In For An AV Interview So We Hired And Filmed Her On The Spot!

  • censoreddeepthroatDANDYdandyparsley okamotoDANDY-710DANDY7101dandy00710
    • 2020-04-23
    68 min

    SIRO-4161 [First Shot] [Rubbing Beautiful Big Tits] [Boyfriend Love Girlfriend ..] Idol Face Girl With Boyfriend. She Has A Cute Smile And She Panting With A Sweet Voice, "No .. No!" .. Av Application On The Net → Av Experience Shooting 1244

  • amateur censoredbig titsamateursirosiro-4161siro4161siro-4161
    • 2020-04-23
    143 min

    [HAVD-995]Lovey-Dovey Love A Young Wife Kissing Lesbian Series Adult Women Look Each Other In The Eyes As They Hold Each Other And Make Each Other Cum

  • aoi mizutani anzu momoi censoredlesbianHAVDhibinodr torihamaHAVD-995HAVD9951havd00995
    • 2020-04-23
    173 min

    [PIYO-072]I Love My Family... - A Tanned Y********l Becomes Her Stepfather's Sex Toy To Save Their Broken Home - The Second Girl Makes Her Porno Debut - Himari Hina

  • hina himari censoredsquirtingdeepthroatPIYOhyokopiero dagrey wolfPIYO-072PIYO0721piyo00072
    • 2020-04-23
    202 min

    [PIYO-071]I Wasn't Supposed To Lay A Hand On This Chick, But She Took A Love Potion, And Wound Up Having Relentless Irrumatio With My Monstrous Cock. And Then... 4 (4)

  • censoredsquirtingschoolgirlPIYOhyokopiero dagrey wolfPIYO-071PIYO0711piyo00071
    • 2020-04-23
    151 min

    [IESP-664]Ichika Matsumoto: Lesbian Awakening: I Made Love With My Step-sister

  • ichika matsumoto aoi kururugi censoredschoolgirllesbianIESPienergykikurinieneIESP-664IESP6641iesp00664
    • 2020-04-22
    151 min

    [GS-1971]Married Woman Hot Water Love Trip 130

  • censoredbig titsGSgostakeshi karakiGS-1971GS1971h-101gs01971
    • 2020-04-21
    180 min

    [GS-1970]Married Woman Hot Water Love Trip - Special Release - Treasured Film Collection(4)

  • censoredGSgostakeshi karakiGS-1970GS1970h-101gs01970
    • 2020-04-20
    116 min

    [GENM-037]No Sluts Allowed! I Only Want To Make Out With A Cute Girl - Eimi Fukada

  • emi fukada censoredsingle workGENMgenekifukadaGENM-037GENM037genm00037
    • 2020-04-19
    120 min

    [HND-822]3 Seconds Before She Confesses Her Love - She Gets Fucked Hard By A Guy With A Huge Cock! - Hinata Koizumi

  • hinata koizumi censoredbig titsblowjobHNDbookhiroaHND-822HND822hnd00822
    • 2020-04-17
    60 min

    FC2PPV 1338145 Kanna 18 Years Old H Cup! 2.5-Dimensional Loli Huge Breasts X Idol-Class Beautiful Girl! Super De Transformation That I Love Raw Vaginal Cum Shot! Big Breasts Big Ass Plump Body Rolled Up With Lust! Conceived In The Finest Body Of A Be

  • amateur uncensoredfc2
    • 2020-04-17
    241 min

    [SIM-069]This Teenage Girl Who Worries About Her Love Life Is Having Her First Follow-Up Creampie JK Soapland Experience!! When She Experiences Her First Ever Lotion Lathered Soapland Plays Her Slippery Pussy Is Ready For His Raw Cock To Just Slip Ri

  • censoredcreampiebig titsSIMprestigeshirotomanmanSIM-069SIM069118sim00069
    • 2020-04-17
    95 min

    [MMFL-001]The Last Night of the Film Studies Club

  • censoreddramaMMFLmarrionzarame tanakamarrion filmsMMFL-001MMFL001mmfl00001
    • 2020-04-17
    240 min

    [MBM-154]I Can Only Love A Mature Woman The Lustful True Nature Of A Beautiful Woman, Brimming With Maternal Instinct And Passion A Ripe Married Woman Who Has All The Best Qualities Of Everything You Could Ever Want (Nampa Seduction Sex) 12 Ladies (C

  • censoredcreampieamateurMBMprestigegaro sasazukambmMBM-154MBM154118mbm00154
    • 2020-04-16
    117 min

    [MVSD-425]I Love My Teacher Beautiful Y********l In School Uniform Deep Kisses And Fucks Her Middle Age Teacher Raw Urara Kaon

  • hanaoto urara censoredcreampieschoolgirlMVSDm s video groupMVSD-425MVSD425mvsd00425
    • 2020-04-14
    59 min

    [041420-001]I Love you to put your dick in my Pussy

  • mone namikata uncensoredcreampiehandjobcaribbeancom
    • 2020-04-14
    70 min

    FC2PPV 1335466 [Appearance / NTR] 19-Year-Old Busty Reading Model Private Sex Leaked! Fan Crying! Actually, I Love Bitch Who Loves Awesome Perverted Sex That I Can Not Be Satisfied With My Boyfriend [Individual Shooting / Uncensored] With Benefits

  • amateur uncensoredfc2
    • 2020-04-12
    159 min

    [CESD-886]A Female Boss Gets Seduced And Broken In By Her New Employee 2 - Kana Morizawa

  • kana morisawa kanako iioka censoredcreampiemature womanCESDceleb no tomoCESD-886CESD886cesd00886
    • 2020-04-12
    130 min

    [SQTE-295]A Quiet Beautiful Girl With A Hidden Naughty Side - Kanon Kanade

  • kanon kanon censoredschoolgirlbeautiful girlSQTEs cuteSQTE-295SQTE295sqte00295
    • 2020-04-12
    80 min

    200GANA-2275 Seriously Nampa, First Shot. 1473 "I Can’T Betray Because I Love My Boyfriend", But A Slender Beauty Who Is Extremely Weak To Push (Laughs) When I Approached With A Push, I Got Messed Up (Laughs)

  • amateur censoredamateurganagana-2275gana2275200gana-2275
    • 2020-04-11
    120 min

    [DASD-663]Sucking And Fucking For Just One Summer. I Fell In Love With A Man's Daughter When I Returned Home, And Fucked Her Every Which Way. Natsu Asahina

  • natsu asahina censoredbeautiful girlDASDdassedogawa orgyDASD-663DASD663dasd00663
    • 2020-04-11
    118 min

    [PRED-221]Right Before The Wedding My Love For My Fiance Melted Away Like Sweat... ~I Was Seduced By My ManagerHZZ

  • aika yamagishi censoredcreampiesingle workPREDpremiumcontour styleelegancePRED-221PRED221pred00221
    • 2020-04-11
    118 min

    [MIAA-258]I Finally Got My First Girlfriend, So I'm Going To Practice Sex And Creampies With My Female Friend First - Ichika Matsumoto

  • ichika matsumoto censoredcreampieschoolgirlMIAAmoodyzeveryone s porn starMIAA-258MIAA258miaa00258
    • 2020-04-10
    120 min

    [MDTM-625]After The Company Party, And After Missing The Last Train Home, I Was Alone With My Co-Worker. We Had No Other Choice But To Check In To A Love Hotel, And That Was The Beginning Of The Thrilling Story Of The Night We Spent S******g In The S

  • mari kaga censoredcreampiesingle workMDTMmedia stationtodouchu kikakuMDTM-625MDTM62561mdtm00625
    • 2020-04-09
    108 min

    [SPRD-1274]The Step-Son: Step-Mother Madly In Love With Her Step-Son With Strong Sex Drive - Rie Takeuchi

  • rie takeuchi censoredmature womansingle workSPRDtakara eizokyuta tukumoaleddinSPRD-1274SPRD127418sprd01274
    • 2020-04-09
    134 min

    [SILK-126]For This Roomshare, I Want To Feel Like My Destiny Is Here.

  • moe hazuki akemi miu censoreddramaSILKsilk labokinosilkSILK-126SILK1261silk00126
    • 2020-04-09
    121 min

    [FSDSS-025]Lovey Lovey Girl Stays Close And Gets What She Wants, Minami Ikuta

  • ikuta minami censoredschoolgirlbeautiful girlFSDSSfalenofaleno starFSDSS-025FSDSS0251fsdss00025
    • 2020-04-09
    215 min

    [SW-695]I Was Reunited With My First Love At A Class Reunion And She Was Now A Lusty Excessively Horny Married Woman! We Were All Taking A Commemorative Photo Together When She Said, "When I'm Filmed While Having Sex, It Makes Me Super Excite

  • censoredSWswitchyocchanswitch switchSW-695SW6951sw00695
    • 2020-04-09
    208 min

    [SW-697]I'm Having A Secret Love Affair With One Of My S*****ts - We Don't Want Anyone To Find Out, But We Filmed A Lovey Dovey Sex Tape

  • censoreduniformSWswitchswitch switchSW-697SW6971sw00697
    • 2020-04-07
    129 min

    [STARS-225]The Girl I Love Who Helped Me Out Is Getting Fucked By Jocks, But... Hikari Aozora

  • hikari aozora censoreduniformbeautiful girlSTARSsod createosamushi sugawarasod starSTARS-225STARS2251stars00225
    • 2020-04-05
    240 min

    [MMB-298]So Turned On At The Thought Of Hot Springs Sex That Their Vaginas Are Getting Steamy Before They Even Check In 6 Girls

  • mai hebei kurata mao censoredMMBmomotaro eizohakase ishikiribashimomotaro s bestMMB-298MMB298mmb00298
    • 2020-04-05
    53 min

    300NTK-340 Transcendental Beauty! !! Suddenly Sex! !! Immediately Continuous Ascension With An Angry Demon Piston! !! Even Though It Turns To Attack At The Woman On Top Posture … Immediately The Muscle Actor’S Power Fully Open Back Station

  • love censoredcreampieamateurntkntk-340ntk340300ntk-340
    • 2020-04-04
    183 min

    [BBAN-272]Exchanging Fluids With The Girl I Love Hot Smothering Kisses And Spit Swapping Sex Lesbians Mixing Cum And Saliva I Want My First Time To Be With Someone I Love... Lesbian

  • eri arimura hikaru konno censoredsquirtinglesbianBBANbibianBBAN-272BBAN272bban00272
    • 2020-04-04
    119 min

    [PRED-232]My C***dhood Friend Had Fleeting Feelings Of Love For Me, And When She Found Out That I Had Been Frequenting Sex Clubs, She Was Furious. "If You Want A Blowjob That Badly, I'll Give You All The Blowjobs You Can Handle!" And So,

  • hasumi claire censoredbig titsblowjobPREDpremiumsuisei akaielegancePRED-232PRED232pred00232
    • 2020-04-04
    66 min

    FC2PPV 1324624 ☆ First Shot ☆ Complete Appearance ☆ Talking Love Fair-Skinned Slender Beauty ♥ Erotic Switch On! Creampie Sex With Erotic Gap ♥ [With Benefits]

  • amateur uncensoredfc2
    • 2020-04-02
    39 min

    [GRCH-361]"Please Teach Me Real Sadism." I Got The Wettest I've Ever Been After I Was Fucked By A Completely Sadistic Boy... Hiroomi Nagase x Kyoko Maki

  • maki kyoko hiroomi nagase censoredbig titsdramaGRCHgirl s chsofeyGRCH-361GRCH3611grch00361
    • 2020-04-01
    119 min

    [NACR-319]Hold Me Tight... Single Moher In Love With Her Neighbor: Sayu Sahara

  • sahara sayu censoredcreampiesingle workNACRplanet plusdirector onanakuruNACR-319NACR319h-237nacr00319
    • 2020-03-31
    67 min

    SIRO-4032 [First shot] [Pure innocent active JD] [Honest body overflows with love juice ..] A naive female college student who has sex for the sixth time in her life. She seems to be shy about the camera .. AV application on the net → AV experience s

  • amateur censoredamateursirosiro-4032siro4032siro-4032
    • 2020-03-31
    60 min

    [033120-001]Lost Love Widow and Brother in Law

  • mona hayami uncensoredcreampiecaribbeancom
    • 2020-03-31
    64 min

    [ETQR-127]Passionate Sex With An Intriguing Colleague - Mari Kagami

  • mari kaga censoredcreampiesingle workETQRerotic timeETQR-127ETQR127h-1186etqr00127
    • 2020-03-29
    132 min

    [SQTE-291]This Girl Is Awesome! She Even Gets Our Stuff Hard! - Mirina Kousaka

  • minami kosaka censoredbeautiful girldeepthroatSQTEs cutes cute premireSQTE-291SQTE291sqte00291
    • 2020-03-29
    148 min

    [SQTE-292]Girls Who Want The D - Sex With Sensitive Beauties

  • rui hizuki yui horizawa censoredblowjobbeautiful girlSQTEs cutes cute premireSQTE-292SQTE292sqte00292
    • 2020-03-28
    121 min

    [WANZ-950]Wait... You're Her Sister!？ My Girlfriend's Sister Looks Just Like Her So I Accidentally Approach The Sister With My Hard Dick. She Eagerly Accepts It And A Hot Load Of Cum! Ai Sayama

  • sayama love censoredcreampiebig titsWANZwanz factorywanzWANZ-950WANZ950wanz00950
    • 2020-03-28
    118 min

    [MIAA-253]I'm Nervous About Sex With My First Girlfriend So I Decided To Use My Best Female Friend As Practice And End Up Cumming Inside Her Rei Kuruki

  • satoshi kuruki censoredcreampieschoolgirlMIAAmoody skikatan for everyoneMIAA-253MIAA253miaa00253
    • 2020-03-28
    149 min

    [JUFE-157]I Love To Feel Good! Big Breasted Yoga Instructor Housewife Enjoys A Sweaty Climax In Her Porn Debut Nami Matsumoto

  • matsumoto nami censoredcreampiebig titsJUFEfitchJUFE-157JUFE157jufe00157
    • 2020-03-27
    178 min

    [EQ-509]Love Hotel Peeping A Married Woman Who Gets Serious For Another Man's Cock 5

  • censoredbig titsamateurEQbullitttosatsu bleetEQ-509EQ509h-100eq00509
    • 2020-03-27
    62 min

    FC2PPV 1315891 ★ Appearance ☆ Too Beautiful Erotic Married Woman Yukari 35 Years Old ☆ Pheromone Mass Secretion Caress ♥ Extreme Blowjob While Impatient ♥ Raw Squirrel Dense Sex Of Love Juice Leaking Dada ♥ Massive Vaginal Cum Shot In Tightening Puss

  • amateur uncensoredfc2
    • 2020-03-27
    113 min

    [HZGD-145]Forbidden Creampie Acts - Happy Days, Furiously Fucking A Man She Loved More Than Her Husband - Yui Nagase

  • yui nagase censoredcreampiesingle workHZGDmarried woman flower garden theaterzampaimageHZGD-145HZGD145h-1100hzgd00145
    • 2020-03-26
    61 min

    413INST-021 "Ultra Rare Awakening" [Personal shooting] Phantom thief Love ○ Eve! Personal shooting with a former child role idol girl found in C96 Summer comics are a treasure trove of erotic ♀. Dream Gonzo Creampie SEX Video [Amateur Shootin

  • amateur censoredcreampiebig titsinstinst-021inst021413inst-021
    • 2020-03-26
    86 min

    [GRCH-355]A Secret Hot Spring Vacation With Alec - Lovey-Dovey Sex From Morning Until Night - Mitsuki Aya

  • aya mitsuki alex censoredsingle workGRCHgirl s chhiroko sabueGRCH-355GRCH3551grch00355



    • Japan xxx, japanese adult videos, japani sexy, Japanese Adult Movies, JAV censored, Japanese tube, Japanese sex online