light fujima




FC2VENXMIDECHRVPREDAUKSLULUHNDROYDVEMAMVSDSPRDSQTEAVSAADNFSDSSATIDMILKAMBIHZGDSSNI

2019-12-26
158 min

[SW-674]This Braless Sch**lgirl Is Teasing Me With A Titty Nip Slip Panty Shot Action Attack. "Hey Bro, Don't You Think My Body Has Grown Up Nicely？" I Met Up With My Little Stepsister For The First Time In Years, And She Started Sweet Ta

  • censoredsisterSWswitchlight fujimaSW-674SW6741sw00674
    • 2019-12-12
    181 min

    [SW-672]Every Morning I Would See This Panty Shot Sch**lgirl In Knee-High Socks And She Was So Cute That She Made My Cock Rock Hard, And She Would Puff Up Her Cheeks And Say To Me, "You're Such A Pervert" And Get Mad At Me. But Then She W

  • yui nagase censoredschoolgirlsingle workSWswitchlight fujimaSW-672SW6721sw00672
    • 2019-12-12
    179 min

    [SW-671]You Want To See My Panties, Don't You？ Okay, I'll Give You A Peek, You Dirty Little Bastard. 2 My Classmate Kanon-san Calls Me Her Little Pet And Cares For Me Every Day Like I'm Her Little Puppy. And As A Reward For Being Good, Sh

  • kanon kanon censoredsingle workSWswitchlight fujimaSW-671SW6711sw00671
    • 2019-11-21
    213 min

    [SW-668]You Want To See My Tits, Right？ - She Teases Guys By Showing Off Her Panties - She Gets Her Kicks By Showing Her Classmates Her Bra, Her Tits And Her Panties - Yua Takanashi

  • yuu takanashi censoredbig titssingle workSWswitchlight fujimaswitch switchSW-668SW6681sw00668
    • 2019-10-24
    184 min

    [SW-662]This Tsundere Little Stepsister Is Giving Her Big Stepbrother Some Loving Panty Shot Action My Little Stepsister Has Grown Up Into Just The Kind Of Babe I Like, And Then She Turned The Tables On Me And Lured Me To Temptation, Saying, "I W

  • yui nagase censoredsistersingle workSWswitchlight fujimaswitch switchSW-662SW6621sw00662
    • 2019-10-10
    186 min

    [SW-660]Every Morning, I See This Sch**lgirl Flashing Panty Shot Action At Me In Her Knee-High Socks And She Was So Cute That She Was Getting My Dick Hard And Then She Said, "You're Such A Pervert." And Then She Got Mad At Me. But Then He

  • kotone rui censoredschoolgirlsingle workSWswitchlight fujimaswitch switchSW-660SW6601sw00660
    • 2019-10-10
    229 min

    [SW-659]Are These Bloomers？ What Should We Do？ Let's Try Them On! Right Before P.E., We Decided To Trade In Our Shorts For Bloomers. These Girls Had Never Worn Bloomers Before, And Now They Were Super Interested! My Classmate Was Wearing Super Ti

  • censoredSWswitchlight fujimaswitch switchSW-659SW6591sw00659
    • 2019-09-12
    159 min

    [SW-654]The Beauty Of A Sch**lgirl In A Ponytail, The Nape Of Her Neck, And Her Panty Shot Pleasure I Was Longingly Looking At Her As She Tied Up Her Hair, And She Was Embarrassed To Be Seen Lifting Her Armpit, And That Made My Heart Leap With Excite

  • censoredschoolgirlSWswitchlight fujimaSW-654SW6541sw00654
    • 2019-08-22
    170 min

    [SW-651]Would You Like To Spend Some Lovey Dovey Time With Me？ I'll Soothe Your Tired Body. The Sch**lgirl Hot Spring Resort I Went To A Secret Hot Spring Resort To Relax From All Of The Stress I Get In My Everyday Life, And There I Met A Cute Sc

  • scooping censoredschoolgirlsingle workSWswitchlight fujimaSW-651SW6511sw00651
    • 2019-08-08
    186 min

    [SW-649]Do You Want To See My Panties？ Well Then I'll Show You! My Classmate Akari-san Always Treats Me Like A Kid. But One Day, Calling It A Special Treat, She Lifts Up Her Skirt And Shows Me Her Panties! It's The Best Day Of My Life! - Akar

  • akari neo censoredschoolgirlsingle workSWswitchlight fujimaswitch switchSW-649SW6491sw00649
    • 2019-08-01
    168 min

    [SW-646]I Love You Ma-kun! We're Finally Lovers! She Used To Be My Childhood Friend, But Today She's My Girlfriend, And Now Her Father-In-Law, And The Other Guys From the Club Are All Intruding On Us Whenever We Try To Get Some Lovey Dovey Lo

  • have censoredsingle workdramaSWswitchlight fujimaswitch switchSW-646SW6461sw00646
    • 2019-08-01
    147 min

    [HBAD-492]At School, With My Teacher... This Sch**lgirl Fell In Love With Her Teacher, And When He Popped His Cock Into Her, Her Young Body Reacted With Sensual Pleasure Nozomi Arimura

  • arimura nozomi censoredschoolgirlsingle workHBADhibinolight fujimababeHBAD-492HBAD4921hbad00492
    • 2019-07-25
    193 min

    [SW-644]Do You Really Want To See A Young Girl's Pants？ Well Then I'll Show You! With Your Face Trapped Between Her Legs, You'll Be Lost For Words And Out Of Breath! Why Are Boys So Interested In Girl's Pants？ Tell Me! I'll Let Yo

  • censoredschoolgirlSWswitchlight fujimaswitch switchSW-644SW6441sw00644
    • 2019-07-11
    135 min

    [SW-641]My Cousin Was A Sch**lgirl Who Was Born Too Late To Know What Bloomers Were All About, So In Order To Prevent Her From Exposing Her Panty Shot Action, I Gave Her Bloomers To Wear Instead Of Tights, And Now She Was Flashing Bloomer Shot Action

  • fujii ringo censoredsingle workSWswitchlight fujimaswitch switchSW-641SW6411sw00641
    • 2019-07-11
    220 min

    [SW-642]Every Morning, I Would See This Young Sch**lgirl In Knee-High Socks Showing Off Her Thighs And Flashing Panty Shot Action At Me, And She Was So Cute That She Was Giving Me A Hard On, And Then She Would Blush And Get Mad And Say, "You'

  • scooping censoredsingle workSWswitchlight fujimaswitch switchSW-642SW6421sw00642
    • 2019-06-20
    137 min

    [SW-638]The Girl With The Big Tits Sitting Next To Me Isn't Wearing Her Bra!! I Can Tell Even With Her Blouse On, that Her Big Titties Are Jiggling With Excitement! I Can Even See Her Nipples, And Oh Boy, Things Are Getting Out Of Control! She Sa

  • inaba censoredbig titsschoolgirlSWswitchlight fujimaswitch switchSW-638SW6381sw00638
    • 2019-06-06
    195 min

    [SW-636]You Like Looking Up Schoolgirl's Skirts, Don't You？ My Adorable Cousins From The Countryside Keep Trying To Seduce Me!

  • censoredSWswitchlight fujimaswitch switchSW-636SW6361sw00636
    • 2019-06-06
    225 min

    [SW-635]The Knee-High Socks And Thighs I See Every Morning. The Panty-Shot Schoolgirl Was So Cute, She Was Giving Me A Boner. "You Dirty Man." She Puffed Her Cheeks And Looked At Me Angrily. But She Quickly Started To Stare At Me With Teary E

  • arimura nozomi censoredsingle workSWswitchlight fujimaswitch switchSW-635SW6351sw00635
    • 2019-05-23
    215 min

    [SW-632]If You Wanna See A Schoolgirl's Panties, Give Me Money! My Cute Cousins Come To My Place Every Day And Pester Me For Money In Return For Playing With Me And Helping Me Around The House While Flashing Their Panties! They Said They'd Ne

  • censoredSWswitchlight fujimaswitch switchSW-632SW6321sw00632
    • 2019-05-09
    170 min

    [SW-629]I Love Ma-kun! I Don't Want To Fuck My Childhood Friend! My Childhood Friend Is Secretly Flashing Panty Shot Action At Me And Even Confessed Her Love To Me In My Dreams. And Finally, We Crossed The Line Into Lovey Dovey Sweet Dreams Schoo

  • have censoredblowjobsingle workSWswitchlight fujimaswitch switchSW-629SW6291sw00629
    • 2019-04-25
    192 min

    [SW-626]She Was The Most Beautiful Girl In Class, And She Seemed Like A Cold Bitch, But For Some Reason She Secretly Lured Me With Sexual Temptation. The Gap In Sensations Was So Amazing And Cute, It Should Be Illegal! Rin Sasahara

  • sakihara rin censoreduniformsingle workSWswitchlight fujimaswitch switchSW-626SW6261sw00626
    • 2019-04-11
    210 min

    [SW-624]The Sporty Sex Of 3 Energetic Sisters With Short Hair!

  • censoredSWswitchlight fujimaswitch switchSW-624SW6241sw00624
    • 2019-04-11
    180 min

    [SW-623]My Little Sister Has Grown Into A Sweet, Affectionate Girl And She's Strangely Sexy. I Know It's Wrong But I Got Addicted To Fucking Her. Azusa Misaki

  • misaki azusa censoredsistersingle workSWswitchlight fujimaswitch switchSW-623SW6231sw00623
    • 2019-03-21
    218 min

    [SW-620]The Schoolgirl I See Every Morning In Knee-High Socks Flashing Her Thighs And Panties Is So Cute, She Makes My Dick Hard. She Gets Angry And Says "You Perv" With Puffed Up Cheeks. But She Quickly Starts To Look At Me With Teary Eyes.

  • mai yahiro censoredschoolgirlsingle workSWswitchlight fujimaswitch switchSW-620SW6201sw00620
    • 2019-03-07
    200 min

    [SW-618]That Old Man Is Looking At Our Panties! Let's Show Him More!! The Schoolgirls At The Family Restaurant Were So Absorbed In Their Conversation, Their Panties Were Showing. They Seemed Annoyed By My Gaze But They Started Showing Me Their Pa

  • censoredschoolgirlSWswitchlight fujimaswitch switchSW-618SW6181sw00618
    • 2019-03-07
    180 min

    [SW-617]It's Your Little Sister's Panties! My Little Sister's Panty Shots Are Merciless! When Our Parents Remarried, I Got Myself A Cute Little Sister But From The Day We Met, Her Cute Ass And Panty Shots Have Been Driving Me Crazy. She E

  • mei harusaki censoredschoolgirlsisterSWswitchlight fujimaswitch switchSW-617SW6171sw00617
    • 2019-02-21
    186 min

    [SW-614]I See Her Knee-High Socks And Thighs Every Morning. The Panty Shots Of A Cute College Girl Was Giving Me A Boner And She Got Mad At Me, Saying "You're A Dirty Man". But She's Really A Bewitching Tsundere Girl And She Started G

  • reiko mizuki censoredschoolgirlsingle workSWswitchlight fujimaswitch switchSW-614SW6141sw00614
    • 2019-02-07
    211 min

    [SW-612]A Female Employee's Black Pantyhose Temptation I'm No Good At My Job, But The Least I Can Do Is Use My Cock To Relieve The Sexual Tensions Of All The Beautiful And Horny Female Employees In The Office And Make Them Scream And Moan Wit

  • censoredslutSWswitchlight fujimaswitch switchSW-612SW6121sw00612
    • 2018-12-20
    176 min

    [SW-601]My Serious, Bespectacled Cousin Is Wearing A G-String! I Never Thought My Serious And Nerdy Cousin Had Any Sex Appeal But When I Caught A Glimpse Of Her G-String, It Was So Unexpected, I Was Captivated! She Was Really A Dirty Girl.

  • censoredlingerieSWswitchlight fujimaswitch switchSW-601SW6011sw00601
    • 2018-12-06
    230 min

    [SW-598]"This Will Cheer You Right Up!" My Barely Legal, Saintly Upperclassmen Say While Getting Me To Get It Up. When I Get In Trouble With Teacher, The Girls Help Lift My Spirits... And Help Me Get Lucky!

  • censoredSWswitchlight fujimaswitch switchSW-598SW5981sw00598
    • 2018-12-06
    198 min

    [SW-599]My Little Sister And Her Friend Wanted To Become Youtubers And Earn Some Money, So They Were Filming Naughty Videos. But They Ended Up Doing Naughty Experiments With Me That Led To Us Fucking So We're Releasing It As Porn.

  • censoredschoolgirlSWswitchlight fujimaswitch switchSW-599SW5991sw00599
    • 2018-11-22
    235 min

    [SW-595]Look! I Can See Her Ass! My Classmate Is Wearing Knee High Socks And Her Thighs Look So Luscious And Her Skirt Is So Damned Short I Can Practically See Her Ass Peeking Out From Underneath And That Thong Is Digging Into Her Bulging Ass Meat! I

  • censoredschoolgirlSWswitchlight fujimaswitch switchSW-595SW5951sw00595
    • 2018-11-08
    190 min

    [SW-592]Crazy Temptation Battle Between Cousins. Meeting My Cousins After A Long Time, I Find Out They've Grown And Have Hot Bodies. They Use Their Sexy Asses To Try To Seduce Me.

  • censoredschoolgirlSWswitchlight fujimaswitch switchSW-592SW5921sw00592
    • 2018-10-25
    155 min

    [SW-589]She's Wearing Gym Shorts So It's Totally OK! A Classmate Who Wears Gym Shorts To Prevent Panty Shots Gets Changed Into Her Gym Clothes In The Classroom And Asks "Boys Like This, Right？" There's Only One Thing To Do.

  • censoredblowjobSWswitchlight fujimaswitch switchSW-589SW5891sw00589
    • 2018-10-11
    208 min

    [SW-587]My Parents Remarried, And I Got A Devilish Little Sister High School Girl Who Sure Loves Her Older Brother! I've Fallen For That Body That's Working So Hard To Seduce Me. Miyuka Araka.

  • arisaka miyuki censoredschoolgirlsisterSWswitchlight fujimaswitch switchSW-587SW5871sw00587
    • 2018-10-11
    155 min

    [SW-586]I'm Going To Roast You Like A Pig! A Glaring Delinquent Schoolgirl And Me. But She's Really Cute And She Gets All Sweet When She's Alone. She's Really A Sheep In Wolf's Clothing And She Can't Say No To Pleasure.

  • censoredschoolgirlSWswitchlight fujimaswitch switchSW-586SW5861sw00586
    • 2018-09-20
    120 min

    [SW-583]Playing Dirty with a Fresh-Faced Country Gal Natsuki Minami

  • south natsuki censoredSWswitchlight fujimaswitch switchSW-583SW5831sw00583
    • 2018-09-06
    177 min

    [SW-581]Every Morning I See Her Knee-High Socks And Luscious Thighs V This Panty Shot Schoolgirl Is So Cute That When My Dick Got Hard For Her, She Blushed And Said Angrily, "You're Such A Pervert!" But Then She Looked At Me With Teary Ey

  • ayuha ami censoredschoolgirlSWswitchlight fujimaswitch switchSW-581SW5811sw00581
    • 2018-08-09
    311 min

    [SW-576]Skirt-Flipping Academy Ever Since Our School Became Coed, Some Of The Schoolgirls Are Still Flipping Their Skirts Up, But The Fact Is That They're Showing Off Their Panties Only To Boys That They Like.

  • censoredSWswitchlight fujimaswitch switchSW-576SW5761sw00576
    • 2018-07-26
    185 min

    [SW-571]Hey Cousin, I'm Dripping Wet! My Nieces Came Over To Play And When I Asked Them To Clean The Bathtub They Got Really Excited! They Got Wet And Wild And I Could See Their Cute Nipples Peeking Out From Underneath Their Wet Clothes And They

  • censoredSWswitchlight fujimaswitch switchSW-571SW5711sw00571
    • 2018-05-24
    230 min

    [SW-559]These Are Panties And Bloomers That Were Made To Be Shown Off! I Would Always See These Student Girls At The Bicycle Parking Lot, And They Would Keep Teasing Me And Flashing Their Bloomers At Me, But Since I Kept Looking At Them With Lust In

  • censoredschoolgirlSWswitchlight fujimaswitch switchSW-559SW5591sw00559
    • 2018-05-10
    217 min

    [SW-556]I See This Schoolgirl Every Morning Wearing Knee High Socks And Showing Off Her Hot Thighs And Panty Shot Action, And She Was So Cute She Made My Dick Hard, And That Got Her Mad And She Said, "You're Such A Pervert!" But She Immed

  • sakaegawa noa censoredschoolgirlSWswitchlight fujimaswitch switchSW-556SW5561sw00556
    • 2018-04-12
    167 min

    [HBAD-415]No No, I'm Cumming! I'm Sorry Sir!! A Clutzy Fresh Face Office Lady With A Sensual Ass In Black Pantyhose Miku Ikuta

  • ikuta miku censoredHBADhibinolight fujimababeHBAD-415HBAD4151hbad00415
    • 2018-04-12
    221 min

    [SW-549]My Classmate Had Delicious Looking Thighs In Knee High Socks, And On Top Of That I Could See That She Was Wearing A Thong Underneath Her Skirt! 3 I Was Covered In Love While A Schoolgirl In Knee High Socks And A Thong Whispered Sweet Nothings

  • censoredSWswitchlight fujimaswitch switchSW-549SW5491sw00549
    • 2018-03-08
    189 min

    [SW-543]My Seriously Sweet Childhood Friend Is Flashing Panty Shot Action At Me! She's Always Got Her Guard Down, And Showing Off Her Panties, And Whenever She Catches Me Watching, She Gets Mad And Beats Up On Me, But She's Actually In Love W

  • sakaegawa noa censoredSWswitchlight fujimaswitch switchSW-543SW5431sw00543
    • 2018-02-22
    223 min

    [SW-540]This Schoolgirl In Knee High Socks Who I Would See Every Morning Was Flashing Panty Shot Action At Me And It Was So Cute That She Got My Dick Hard, And She Squealed, "You're Such A Pervert!" And Puffed Up Her Cheeks In Anger But S

  • sena ai censoredschoolgirlsingle workSWswitchlight fujimaswitch switchSW-540SW5401sw00540
    • 2018-02-08
    226 min

    [SW-537]A Tsundere Little Devil Girl In Bloomers We're Gonna Grope This Schoolgirl's Bloomers Ass!! Aya Sazanami

  • censoredslutsingle workSWswitchlight fujimaswitch switchSW-537SW5371sw00537
    • 2017-07-06
    167 min

    [SW-494]After This Schoolgirl Kept Flashing Her Panties At Me And I Could No Longer Resist, She Secretly Kept Cumming At Me For Sex, And Since I Had No Other Choice, I Fucked Her

  • censoredschoolgirlslutSWswitchlight fujimaswitch switchSW-494SW4941sw00494
    • 2017-06-15
    187 min

    [SW-491]"You Can Do Anything You Want With Me, Cousin." I Went To Visit My Cute Cousin In The Country, And She Looked So Sweet When She Slept That I Couldn't Help Peeking At Her Panties.

  • censoredschoolgirlSWswitchlight fujimaswitch switchSW-491SW4911sw00491
    • 2017-06-01
    195 min

    [HBAD-367]No No, I'm Cumming! We're Rubbing Our Cocks Up Against These Pantyhose Office Lady Wives' Asses She Thought It Was My Dick Rubbing Up Against Her When It Was Actually My Co-Worker, And They Fell In Love, While I Was Stuck Waitin

  • yuri sasahara censoredsingle workdramaHBADhibinolight fujimababeHBAD-367HBAD3671hbad00367
    • 2017-05-18
    178 min

    [SW-485]Even If We Can't See These Schoolgirl Panties, When They're Wearing Those Mini Spats, It Makes Their Asses Bulge And Look Much Tighter, So We'll Forgive The Bitches And It Seems The Girls Don't Mind Being Stared At Either, So

  • censoredschoolgirllingerieSWswitchlight fujimaswitch switchSW-485SW4851sw00485
    • 2017-05-03
    190 min

    [SW-482]My Classmate Is Wearing Knee High Socks That Make Her Thighs Look So Delicious, And I Was Amazed To See That Underneath Her Skirt She Was Wearing A Thong! I Was Enveloped In The Sweet Love Of A Schoolgirl In Knee High Socks And A Thong As She

  • censoredschoolgirlSWswitchlight fujimaswitch switchSW-482SW4821sw00482
    • 2017-04-20
    208 min

    [SW-479]You Like My Ass, Don't You？ This Schoolgirl Little Sister Loves Her Big Brothers, So She's Always Prancing Around Wearing Nothing But Bloomers, Or White Panties, Or Mini Tights, Or Swimsuits, Or Thongs, So She Can Show Off Her Pretty

  • shiina sky censoredsistersingle workSWswitchlight fujimaswitch switchSW-479SW4791sw00479
    • 2017-04-06
    195 min

    [SW-476]Am I Going To Become Your Teacher's Pet(Sex Toys)？ I'm A Private Tutor, And I Was Surprised To Meet Such A Pure And Innocent Schoolgirl As My New Student, So I Decided To Obey My Lust And Had Her Tied Up And Am Now Using Her As My Mas

  • censoredschoolgirlsisterSWswitchlight fujimaswitch switchSW-476SW4761sw00476
    • 2017-01-19
    200 min

    [SW-461]A Cocky Little Devil A Schoolgirl In Knee High Socks Sora I Was Staring At My Friend's Little Sister Who Was Commanding Total Domain And Flashing Panty Shot Action At Me, When She Screamed At Me. Pervert! Horndog! Idiot! But She Was So Cu

  • shiina sky censoredschoolgirlSWswitchlight fujimaswitch switchSW-461SW4611sw00461
    • 2016-08-18
    210 min

    [SW-430]When I See The Cute Girls In Class Flashing Panty Shot Action, I End Up Buying Their Panties After They Bashfully Lift Up Their Skirts And Show Me. But When We're Together Alone, She Suddenly Becomes Shy, And Says, "Be Gentle When You

  • censoredSWswitchlight fujimaswitch switchSW-430SW4301sw00430



    • Japan xxx, japanese adult videos, japani sexy, Japanese Adult Movies, JAV censored, Japanese tube, Japanese sex online