javcensored upskirt high vision censored




FC2NGODMIAAGVHKBILULUAWDSSNISSISHMNNACRHDKAMIDVSQTESTARSDASDCJODSANHUNTBVENXGMEM

2019-12-10
261 min

[EQ-490]When My Dad Got Remarried, I Suddenly Had A New Stepmom (Big Tits), A New Little Stepsister (Tiny Tits), And Now We're Keeping It In The Family With Creampie Sex!？ They're Always Prancing Around Scantily Clad, Looking Sexy, And Flashi

  • censoredcreampiebig titsEQbullittitazuraEQ-490EQ490h-100eq00490
    • 2019-12-08
    127 min

    [ARM-822]A Little Devil Temptation By An Intellectual Girl

  • chiharu miyazawa akemi miu censoredslutARMaroma planningkijin kasaiaromaARM-822ARM822arm00822
    • 2019-12-08
    105 min

    [ARM-819]A Regular Woman Who Works At A Cafe Is Not Used To Always Taking On Challenges This Old Man Wants A Clothed Woman To Give Him Some Nookie, So She Tells Him, I'll Make You Feel Better! Rika Miama

  • beautiful sweetness censoredsingle workARMaroma planninghamu oujiaromaARM-819ARM819arm00819
    • 2019-12-07
    148 min

    [MIAA-197]Tempted By My Shy-Girl Step-Daughter I Can't Hold Back When She Provokes Me By Giving Me A Full View Of Her Unprotected Panties Mizuki Yayoi

  • mizuki yayoi censoredschoolgirlbeautiful girlMIAAmoodyzgoemoneveryone s porn starMIAA-197MIAA197miaa00197
    • 2019-11-30
    227 min

    [HUNTA-686]I'm In A Cramped Bathtub With My Excessively Big Tits Big Stepsister! I Was Getting Fucked For 3 Days And 2 Nights And Now I Was At My Absolute Limit! My Big Stepsister Came To Town To Stay With Me At My Small Apartment...

  • censoredcreampiesisterHUNTAhunterkawajirihhh groupHUNTA-686HUNTA686hunta00686
    • 2019-11-26
    90 min

    [NUBI-033][Public Fucking] The Extreme Service At This Intense Underground Idols Meet-And-Greet Event Is Just A Ruse To Fuck The Girls In Public

  • censoredamateurNUBIkalimantannubiaNUBI-033NUBI033h-1112nubi00033
    • 2019-11-24
    149 min

    [MMUS-038]A Little Devil Tempting Beautiful Girl Amy Fukada

  • emi fukada censoredbeautiful girlsingle workMMUSmarrionkijin kasaikcpMMUS-038MMUS038mmus00038
    • 2019-11-23
    152 min

    [MIAA-194]A Quickie Fuck Gal Who Gets Old Men Hard With Panty Shot Temptation

  • censoredbeautiful girlMIAAmoodyzhatatai ryoeveryone s porn starMIAA-194MIAA194miaa00194
    • 2019-11-23
    119 min

    [MIAA-191]Begging Backdoor Piston Pumping Sex 2 A Horny Beautiful Young Babe In Uniform Who Will Lure You To An Erection With Panty Shot Temptation Yui Nagase

  • yui nagase censoreduniformbeautiful girlMIAAmoodyzdragon nishikawaeveryone s porn starMIAA-191MIAA191miaa00191
    • 2019-11-22
    140 min

    [HZGD-132]My Friend's Wife Seduces Me With Her Voluptuous Body And Her Huge Ass - Adulterous Banging With A Massage Therapist - Kanna Shinozaki

  • kina shinozaki censoredcreampiebig titsHZGDmarried woman flower garden theaterhirokoji osakiHZGD-132HZGD132h-1100hzgd00132
    • 2019-11-21
    213 min

    [SW-668]You Want To See My Tits, Right？ - She Teases Guys By Showing Off Her Panties - She Gets Her Kicks By Showing Her Classmates Her Bra, Her Tits And Her Panties - Yua Takanashi

  • yuu takanashi censoredbig titssingle workSWswitchlight fujimaswitch switchSW-668SW6681sw00668
    • 2019-11-21
    122 min

    [GS-299]A Crudely Sexy Saleswoman Has Come To My Home And I'm The Only One Here! She Was So Hot And Erotic, I Let My Guard Down, And Let Her In The House, And Then...

  • censoredcreampieslutGSsosoru x garconspada ikebukuroGS-299GS2991gs00299
    • 2019-11-19
    135 min

    [STARS-161]For Some Reason, The Cutest Girl In School Wants To Show Me Her Panties, Tempting Me To Fuck Her - Ichika Nagano

  • ichika nagano censoredschoolgirlbeautiful girlSTARSsod createkijin kasaisod starSTARS-161STARS1611stars00161
    • 2019-11-18
    115 min

    [FGAN-002]My Personal Panty Shot Doll Chiharu Chiharu Miyazawa

  • chiharu miyazawa censoredcreampiesingle workFGANfetish eyesFGAN-002FGAN002h-1440fgan00002
    • 2019-11-18
    130 min

    [FGAN-004]This Beautiful Young Girl's Plump Pussy Makes Me Hard - Mizuki Yayoi

  • mizuki yayoi censoredcreampiebeautiful girlFGANfetish eyesFGAN-004FGAN004h-1440fgan00004
    • 2019-11-14
    179 min

    [HUNTA-682]Hey... Who Do You Want To Fuck First？ I Suddenly Ended Up With A New Sister-In-Law And We're Sharing A Room Together Too! We Were Sleeping Together And Then I Was Having A Miraculous, Divine Threesome Experience!! When Our Parents Got

  • censoredblowjobsisterHUNTAhuntermorikihhh groupHUNTA-682HUNTA682hunta00682
    • 2019-11-14
    210 min

    [SSNI-618]Total Domain A Voluptuous Thighs In Uniform Peek-A-Boo Show A Bare-Legged Idol In The Ultimate Temptation A Little Devil Beautiful Girl In Knee-High Socks Yua Mikami

  • yua mikami censoredbig titssingle workSSNIs one number one stylebungo maedas1 no 1 styleSSNI-618SSNI618ssni00618
    • 2019-11-14
    240 min

    [HUNTA-684]I Moved To Tokyo And Now I Live In An Apartment Located 5 Minutes From My Trade School! But Every Day, The Girls From Class Come Over To Spend The Night... I Was Enjoying My Life, Living On My Own...

  • censoredblowjobHUNTAhunterkawajirihhh groupHUNTA-684HUNTA684hunta00684
    • 2019-11-09
    120 min

    [MIAA-181]A Little Devil In Black Tights This Beautiful Young Girl In Uniform Kept On Luring Me To Temptation With Her Tight And Beautiful Legs In Silky Smooth Tights As She Guided Me To Ejaculation Mitsuki Nagisa

  • scooping censoredbeautiful girlslutMIAAmoody ssapporo taroeveryone s kikatanMIAA-181MIAA181miaa00181
    • 2019-11-09
    118 min

    [MIAA-185]A Cherry Boy Little Stepbrother Who Took His Big Stepsister's Provocations Seriously And Didn't Realize That She Had Already Cum And Kept On Pumping Away At Her Pussy With Out-Of-Control Fury Kanon Kanade

  • kanon kanon censoredschoolgirlbeautiful girlMIAAmoodyzhatatai ryoeveryone s porn starMIAA-185MIAA185miaa00185
    • 2019-11-08
    125 min

    [ARM-811]Showing Pants Then Using Them to Romance in the Office!

  • mihina azumihina mihina nagai ayaba miori censoredsluthandjobARMaroma planningmania satoshiaromaARM-811ARM811arm00811
    • 2019-11-08
    108 min

    [ARM-813]I'm At Work, But This Elder Sister Type Is Luring Me To Temptation By Shoving Her Panty-Covered Pussy Into My Face

  • mihina azumihina mihina nagai umi hyuga censoredsluthandjobARMaroma planninghamu oujiaromaARM-813ARM813arm00813
    • 2019-11-08
    117 min

    [ARM-810]Uniform 25 cm Above The Knee, Panties, And A Blowjob

  • rei kitano tsukimiya koharu censoredschoolgirlblowjobARMaroma planningshigeo kadowakiaromaARM-810ARM810arm00810
    • 2019-11-08
    111 min

    [VRTM-464]"You Want To See My Panty Shot Action, Don't You？" This Neat And Clean Girl Is Tempting Me By Begging For A Quickie! She's Hiding From Her Mom And Getting Her Father-In-Law's Cock For A Cum Crazy Orgasmic Good Time! And

  • scooping hikaru minazuki censoredcreampieVRTMv r producerokutanzo no seishiVRTM-464VRTM464h-910vrtm00464
    • 2019-11-02
    187 min

    [HUNTA-676]I Was Practicing Some Hard Deep Throat Piston Pumping Action With My Pushover Little Sister-In-Law, When She Got Her Pussy So Dripping Wet That She Started To Massively Stain Her Panties!! I Had Just Finished Unloading My Cock Into Her Thr

  • censoredsisterdeepthroatHUNTAhuntermorikihhh groupHUNTA-676HUNTA676hunta00676
    • 2019-10-24
    184 min

    [SW-662]This Tsundere Little Stepsister Is Giving Her Big Stepbrother Some Loving Panty Shot Action My Little Stepsister Has Grown Up Into Just The Kind Of Babe I Like, And Then She Turned The Tables On Me And Lured Me To Temptation, Saying, "I W

  • yui nagase censoredsistersingle workSWswitchlight fujimaswitch switchSW-662SW6621sw00662
    • 2019-10-20
    121 min

    [ARM-808]Slick And Slippery Lotion Lathered Twat-Emphasizing Panties And Pussy-Grinding Services

  • hikaru minazuki alice toyonaka censoredslutARMaroma planninghamu oujiaromaARM-808ARM808arm00808
    • 2019-10-20
    108 min

    [ARM-806]Miki Sunohara x Tight Miniskirt Thick Ultimate Plan

  • future sunohara censoredcosplaysingle workARMaroma planningshigeo kadowakiaromaARM-806ARM806arm00806
    • 2019-10-20
    120 min

    [ARM-807]Guys Who Like Upskirt Peeping Will Definitely Be Satisfied! G-Spot Masturbation With Fingers Through Holes In Pants

  • mihina azumihina mihina nagai hikaru minazuki censoredsquirtingARMaroma planninghamu oujiaromaARM-807ARM807arm00807
    • 2019-10-18
    171 min

    [DOCP-177]One Day, My Wife Suddenly Demanded A Divorce, And I Became A Single Father, And The Big Tits Housewives From The Neighborhood Took Pity On Me And Started Helping Me Around The House! And When These Luscious Wives Unwittingly Flashed Panty S

  • misono waka hayama natsuna censoredbig titsDOCPprestigedoc premiumDOCP-177DOCP177118docp00177
    • 2019-10-10
    186 min

    [SW-660]Every Morning, I See This Sch**lgirl Flashing Panty Shot Action At Me In Her Knee-High Socks And She Was So Cute That She Was Getting My Dick Hard And Then She Said, "You're Such A Pervert." And Then She Got Mad At Me. But Then He

  • kotone rui censoredschoolgirlsingle workSWswitchlight fujimaswitch switchSW-660SW6601sw00660
    • 2019-10-10
    123 min

    [GS-289]We're Exploring Abandoned Buildings With Our College Club Friends! We Paired Up In Boy-Girl Teams, And When This Girl's Titties Kept Bumping Up Against My Arm, And She Started Showing Off Her Crouching Panty Shot Action At Me, I Knew

  • censoredGSsosoru x garconkinton kuriGS-289GS2891gs00289
    • 2019-10-08
    138 min

    [ARM-802]The Pussy Doctor Is Giving A Medical Examination And Prodding At Her Ultra-Thin Panties A Medical Journal Entry

  • chiharu miyazawa rio okita censoredARMaroma planninghamu oujiaromaARM-802ARM802arm00802
    • 2019-10-03
    320 min

    [HUNTA-662]I'm Super Popular With Girls In Knee-High Socks x Miniskirt Outfits, And I'm Fucking The Shit Out Of Them Too!! I Enrolled Into A New School, Which Was An All Girls School Until Last Year, And Just Turned Coed This Year!! During Ju

  • censoredschoolgirlHUNTAhuntervolvo nakanohhh groupHUNTA-662HUNTA662hunta00662
    • 2019-09-27
    174 min

    [FNEO-039]Attention All Men! Be Cautious Of Girls In The Library! "Shhhh! Be Quiet Or You'll Get In Trouble! But On The Other Hand..." Unable To Resist Her Sexy Temptation In The Library, You're On The Prowl For That Prim And Proper G

  • yuri fukada ai minano censoredcreampieschoolgirlFNEOfirst staryosukefirst star neoFNEO-039FNEO039h-491fneo00039
    • 2019-09-26
    159 min

    [SW-655]My Stepsister And Her Friends Are Devilish Little Sluts! They Came Over To My House And Lured Me To Miniskirt Panty Shot Temptation, And While My Little Stepsister Was Looking The Other Way, I Shoved My Big Orgasmic Cock Into Their Pussies An

  • censoredslutsisterSWswitchyocchanswitch switchSW-655SW6551sw00655
    • 2019-09-26
    129 min

    [GS-285]I Was So Busy I Couldn't Do Any Housework, So I Had To Hire A Housekeeper... And To My Surprise, A Sexy Married Woman Arrived!! And She Was Luring Me To Temptation With Massive, Excessively Erotic Pheromones Pumping Out From All Over Her

  • censoredGSsosoru x garcontumblerGS-285GS2851gs00285
    • 2019-09-26
    140 min

    [KMHR-081]Arare Mochizuki Total Domain Her Excessively Sexy Smooth Thighs & Panty Shot Action Are Luring Her Cherry Boy Students To Temptation A Private Tutor In Knee-High Socks

  • mochizuki hail censoredsingle workKMHRsod creategoemoni fell in love with youKMHR-081KMHR0811kmhr00081
    • 2019-09-20
    241 min

    [DOCP-172]"I Already Came..." My Little Sister Teased Me About Me Still Being A Cherry BoyBy Flashing Her Panties At Me So I Fucked Her Wildly And Made Her Orgasm Over And Over Again! vol. 2

  • yui nagase natsuho imai censoredschoolgirlbeautiful girlDOCPprestigedoc premiumDOCP-172DOCP172118docp00172
    • 2019-09-14
    195 min

    [HUNTA-654]"Are You Showing Me Your Panties On Purpose？" There's A High School Girl Working Part-Time At The Bakery Where I Work, And She Keeps Her School Uniform On, Making Her 130 Cute!

  • censoreduniformschoolgirlHUNTAhunterkoichi davidsonhhh groupHUNTA-654HUNTA654hunta00654
    • 2019-09-13
    107 min

    [VRTM-452]"Oh My... You Aren't Trying To Lure Me To Temptation, Are You...？" He Was Alone In The House With His Big Brother's Girlfriend, And All She Was Wearing Was A Single Button-Down Shirt, And No Bra Over Her Big Tits! He Could S

  • anne mashiro hamazaki mao censoredcreampiebig titsVRTMv r produceken hosokawaVRTM-452VRTM452h-910vrtm00452
    • 2019-09-13
    121 min

    [VRTM-453]This Little Brother-In-Law Is Lusting For His Kind And Gentle Big Ass Big Sister-In-Law Who Wears A Tight Skirt! When He Gave Her Aphrodisiacs To Drink She Started Rubbing Her Knee-High Socks Up Against Him And Staining Her Panties, And The

  • otsuki sound yuki sakuragi censoredcreampiesisterVRTMv r producerokutanzo no seishiVRTM-453VRTM453h-910vrtm00453
    • 2019-09-12
    110 min

    [GS-282]This Little Stepsister Is Wearing A Short Uniform Skirt, And She's Always Flashing Panty Shot Action At Me! When I Warned Her, She Started Wearing Bloomers To Prevent Any More Panty Shot Action!？ But She Has No Problem Flashing Her Crotch

  • censoreduniformsisterGSsosoru x garconkinton kuriGS-282GS2821gs00282
    • 2019-09-12
    159 min

    [SW-654]The Beauty Of A Sch**lgirl In A Ponytail, The Nape Of Her Neck, And Her Panty Shot Pleasure I Was Longingly Looking At Her As She Tied Up Her Hair, And She Was Embarrassed To Be Seen Lifting Her Armpit, And That Made My Heart Leap With Excite

  • censoredschoolgirlSWswitchlight fujimaSW-654SW6541sw00654
    • 2019-09-08
    118 min

    [ARM-794]Strong Desire For Beautiful Legs: I Want To Finish Off On Your Bare-Skinned Legs

  • kanae lennon sumire kurokawa censoredARMaroma planninghamu oujiaromaARM-794ARM794arm00794
    • 2019-09-08
    210 min

    [MIRD-193]Lucky Punch The Academy Provocation Chiralism Harem

  • sena ai remi hayami censoredschoolgirlMIRDmoodyzkijin kasaimoodyz realMIRD-193MIRD193mird00193
    • 2019-09-05
    166 min

    [SSNI-555]I Can See My Girlfriend's Sister's Panties! My Girlfriend Is Right Next To Us But Her Slutty Older Sister Brazenly Tries To Seduce Me! Moe Amatsuka

  • angel moe censoredslutsingle workSSNIs1 no 1 stylegoemonSSNI-555SSNI555ssni00555
    • 2019-09-05
    236 min

    [ATOM-388]Titty Flashes And Pussy Flashes Galore! Amateur Young Lady Babes We Me At A Hot Springs Resort Only! Would You Like To Play The Twister Game Wearing Only A Towel？ 2

  • censoredATOMatomwhatta gianthhh groupATOM-388ATOM388atom00388
    • 2019-09-01
    139 min

    [MMUS-035]A Devilish And Tempting Beautiful Girl Nozomi Arimura

  • arimura nozomi censoredbeautiful girlsingle workMMUSmarrionkijin kasaikcpMMUS-035MMUS035mmus00035
    • 2019-08-22
    170 min

    [NHDTB-311]A Sensual Girl Who Was Stripped Down To Her Underwear In A Crowded Train By Molester Teachers And Couldn't Defy Them As She Was Humbled By Shame

  • censoredsquirtinglingerieNHDTBnatural highkansukeNHDTB-311NHDTB3111nhdtb00311
    • 2019-08-22
    150 min

    [SW-650]My Friend's Girlfriend Is A Seductive Slut Who Lets Me See Her In Her Underwear And Puts The Moves On Me. With Her Boyfriend Right Next To Us, She Secretly Puts My Hard Cock Inside Her, Saying "I'm So Turned On Right Now, What Sha

  • censoredbig titsSWswitchyocchanSW-650SW6501sw00650
    • 2019-08-16
    162 min

    [SSNI-550]This Tsundere Little Sister-In-Law Is Prancing Around Without A Care In The World, Flashing Panty Shot Temptation Every Day Mako Iga

  • iga mako censoredschoolgirlsisterSSNIs1 no 1 stylekyoseiSSNI-550SSNI550ssni00550
    • 2019-08-09
    152 min

    [ZMEN-022]A Working Nurse's Careless Panty Shots Are So Angelic, My Dick Is Rock Hard!

  • mai yahiro aoi mizutani censoredblowjobnurseZMENz mengoro koenjiZMEN-022ZMEN022h-1371zmen00022
    • 2019-08-08
    170 min

    [SW-648]The Young Ladies In My Hometown Walk Around With Their Big Sexes Asses Almost Falling Out Of Their Miniskirts. I Tried Taking A Peek, And The Girls Actually Got Excited, Practically Begging Me To Ram My Hard Cock Inside Them!

  • censoredSWswitchyocchanswitch switchSW-648SW6481sw00648
    • 2019-08-08
    128 min

    [GS-277]My Sister-In-Law Came To Visit While My Wife Was Out! She Lounged Around The House With No Bra And Her Panties Showing! I Didn't Know Where To Look, So I Turned The TV On, But I Forgot I'd Left A Porno DVD In The Machine...!

  • censoredsisterGSsosoru x garconona pGS-277GS2771gs00277
    • 2019-08-08
    186 min

    [SW-649]Do You Want To See My Panties？ Well Then I'll Show You! My Classmate Akari-san Always Treats Me Like A Kid. But One Day, Calling It A Special Treat, She Lifts Up Her Skirt And Shows Me Her Panties! It's The Best Day Of My Life! - Akar

  • akari neo censoredschoolgirlsingle workSWswitchlight fujimaswitch switchSW-649SW6491sw00649



    • Japan xxx, japanese adult videos, japani sexy, Japanese Adult Movies, JAV censored, Japanese tube, Japanese sex online