javcensored massage censored slender jav




FC2MARAABWVENXHODVONEZAUKGAUKGPPPDSQTEATIDSANCAWDNACRHMNSPRDBLKSSISSDABHNDMVSD

2021-02-23
140 min

[STARS-330](Enjoy Yourself In 4K!) Welcome To The Paradise Of Healing Southern Erotic Spa Suzu Honjo

  • suzu honjo censoredcreampiesingle workSTARSsod createhiroshi sasakurasod starSTARS-330STARS3301stars00330
    • 2021-02-12
    159 min

    [MDBK-160]Submissive Guys Only: Dirty Talking Reflexologist Enveloping Your Entire Body In Pleasure With Detox Oil

  • kimi and ayumi sarina kurokawa censoredcreampieMDBKbazookak taroMDBK-160MDBK160h-1496mdbk00160
    • 2020-12-31
    118 min

    [JUL-438]I Understood What Real Pleasure Was After I Got My G-Spot Developed Rumi Mochizuki

  • rumi mochizuki censoredmature womansingle workJULmadonnamametaro mamezawaJUL-438JUL438jul00438
    • 2020-12-26
    162 min

    [JUFE-240]Sexual Chiropractic NTR This Chiropractor's Secret Techniques Are So Amazing, It Doesn't Matter If My Boyfriend Is Here He Made This College Girl Cum, Over And Over Again Himari Kinoshita

  • himari kinoshita himari hanazawa censoredsingle workJUFEfitchJUFE-240JUFE240jufe00240
    • 2020-12-21
    116 min

    [BLOR-158]A 180cm-Tall Girl This Otaku Girl With Manly Looks Is Getting A Big Hard Cock Plunged Into Her Pussy Until She Melted Like Butter And Started Cumming Like A Bitch!

  • censoredBLORbroccoli mousouzokubroccolibroccoliBLOR-158BLOR158blor00158
    • 2020-12-17
    157 min

    [SSNI-943]Massage Parlor Slut Will Bust Your Nut With Her Incredible Hand And Tongue Techniques Ichika Hoshimiya

  • ichika hoshimiya censoredsquirtingsingle workSSNIs1 no 1 stylemonSSNI-943SSNI943ssni00943
    • 2020-12-12
    117 min

    [EBOD-786]Her Hips Are Way Too High Up! She's 173cm Tall, With An 89cm Inseam, So That Makes Her Something Between A Model And An Amateur, And Here She Is, Performing In An Adult Video She Looks Like A Cool Customer, But She's A Super Naive E

  • censoredEBODe bodytake dEBOD-786EBOD786ebod00786
    • 2020-12-10
    123 min

    [FSDSS-138]Massage Parlor G-Spot Training That Commands Her To Stare Right Into The Camera As Her Cunt Spasms Natsu Tojo

  • natsu tojo censoredbeautiful girlsingle workFSDSSfalenotake dfaleno starFSDSS-138FSDSS1381fsdss00138
    • 2020-11-13
    170 min

    [JUFE-224]Hit On Until She Cheats At The Massage Parlor - Her Masseur's Hands Feel So Good That This College Girl Doesn't Care That Her Boyfriend Is Right There And Cums Hard Karen Otoha

  • karen otoha censoredJUFEfitchJUFE-224JUFE224jufe00224
    • 2020-11-06
    60 min

    [PARATHD-3026]Voyeur Footage Of Adult Massage Parlor Popular With Mature Women (6): Watch Them Go Wild With Pleasure As The Secret Massage Techniques Get Their Pussy Juices Overflowing

  • censoredcreampieblowjobPARATHDparadise tvPARATHD-3026PARATHD3026parathd03026
    • 2020-11-01
    240 min

    [SCR-256]Totally Private Salon - Posting Personal Footage, Highlights Collection - 4 Hours - Every Single Customer Comes Back For More - Do You Indulge In Illicit Sex Or Not？ It's All Up To You-

  • censoredcreampieblowjobSCRglay zs crimeSCR-256SCR25612scr00256
    • 2020-09-12
    152 min

    [EBOD-766]Honeymoon Reverse NTR This Massage Therapist With An Erotic Body Kept On Creampie Fucking Me And My Newlywed Wife Almost Found Out I Was Cheating On Her During Our First Night At Our Hotel During Our Honeymoon Hazuki Wakamiya

  • wakamiya censoredbig titsbeautiful girlEBODe bodygoemonEBOD-766EBOD766ebod00766
    • 2020-08-23
    120 min

    [AGMX-058]Super Throbbing Continuous Orgasms From Erotic Oil Massage

  • yano tsubasa scooping censoredbig titsbeautiful girlAGMXsex agent daydreamersminimal iwamurasex agentAGMX-058AGMX058agmx00058
    • 2020-08-07
    37 min

    [CLO-068]Our Eyes Met During My Massage - Lennon Kanae

  • kanae lennon censoredsingle workCLOchobitchsuper bitchCLO-068CLO068h-1435clo00068
    • 2020-07-21
    180 min

    [EMOIS-004]Three Loves, First Threesome, Oil Massage Middle-Aged Licking Everywhere, Super Extra Amateur Girls, Rina Hyuga (22)

  • hyuga rina censoredamateursingle workEMOISsod createbacon tanakaemotional girlEMOIS-004EMOIS0041emois00004
    • 2020-07-16
    128 min

    [MXGS-1145]Back To Back Creampie Passionate Men's Massage Parlor! Unending Cumshot Milking Oil Massage, Mizuki Yayoi

  • mizuki yayoi censoredcreampiebeautiful girlMXGSmaxingkeiha nobuyoMXGS-1145MXGS1145h-068mxgs01145
    • 2020-07-04
    54 min

    [HHKL-045]"Please Don't Fuck Me Anymore!" Continuous Repeat Business! This Massage Parlor Outlaws Touching, But When This Fresh Face Babe Gets Asked, She Cannot Refuse, And Now She's Standing Up And Getting Some Raw Cocks Pumped Into

  • censoreduniformHHKLhuntermorikihhh groupHHKL-045HHKL045hhkl00045
    • 2020-07-01
    123 min

    [SCR-244]Private Room Salon Leaked Footage 4 - A Body Clinic With 100 Satisfaction Rate Where It's Up To You Whether You Get Fucked

  • censoredcreampieblowjobSCRglay zs crimeSCR-244SCR24412scr00244
    • 2020-05-19
    69 min

    [EMOI-010]An Emotional Girl/Her 4th Video/Oil Massage Ecstasy/A Big Dick Massage Therapist/Peeping Hidden Camera Footage/148cm Tall/B-Cup Titties/Rina Hiyuga (22)

  • hyuga rina censoredbeautiful girlsingle workEMOIsod createbacon tanakaemotional girlEMOI-010EMOI0101emoi00010
    • 2020-05-09
    170 min

    [DASD-672]Aphrodisiac Oiled Back-Breaking Orgasmic Massage Parlor Sex Kotone Toa

  • toua kotone ichijo mio censoreddramaDASDdasskonjac kanoDASD-672DASD672dasd00672
    • 2020-05-09
    120 min

    [IPX-483]A Lusty Busty Tit-Enlargening Salon A Perverted Middle-Aged Therapist Provided My Girlfriend With An Aphrodisiac Massage Until She Learned To Cum With Her Nipples Suzu Monami

  • monami bell censoredsquirtingIPXidea pockettissueIPX-483IPX483ipx00483
    • 2020-04-01
    121 min

    [SCR-237]Private Salon Video 3 ~ Body Clinic With A 100 Return Rate Whether The Sex Is Up To Snuff Or Not Is Up To You ~

  • censoredcreampieblowjobSCRglay zs crimeSCR-237SCR23712scr00237
    • 2020-03-28
    120 min

    [MIAA-247]Slender Girl With Exquisite A-Cup Breasts, Ichika Matsumoto

  • ichika matsumoto censoredblowjobsingle workMIAAmoody seightkikatan for everyoneMIAA-247MIAA247miaa00247
    • 2020-03-28
    148 min

    [MIAA-245]180cm Tall Tattooed Beauty Getting An Oil Massage And A Creampie: Eru Sato

  • sato l censoredcreampiedeepthroatMIAAmoodyzkitorune kawaguchieveryone s porn starMIAA-245MIAA245miaa00245
    • 2020-03-27
    75 min

    259LUXU-1244 Luxury TV 1239 Dreamy with the finest oil massage by a professional therapist! Repeatedly cums after being stabbed by a gun with a stubborn ○ port that is on the verge of an outburst!

  • amateur censoredbig titsamateurluxuluxu-1244luxu1244259luxu-1244
    • 2020-03-21
    136 min

    [DASD-649]Lonely Whorehouse, Uniform Sexual Massage

  • scooping kanon ichikawa censoredbeautiful girldramaDASDdasrokusaburo mishimaDASD-649DASD649dasd00649
    • 2020-03-13
    192 min

    [RIX-075]Super Strong!! Awakening Her Sensuality With A Sensual Massage Laced With 3 Types Of Aphrodisiacs

  • censoredbig titsamateurRIXprestigerelaxation roomRIX-075RIX075118rix00075
    • 2020-02-14
    149 min

    [RIX-074]Couple Simultaneously Cheating On Each Other While Getting a Massage 2

  • censoredbig titsamateurRIXprestigeno directorrelaxation roomRIX-074RIX074118rix00074
    • 2020-01-11
    150 min

    [MIDE-727]The Fun Doesn't Stop No Matter How Many Times You Cum! - Sexual Stimulation Oil Massage - Miyu Misaki

  • misaki misaki censoredsingle workMIDEmoodyzgoemonmoodyz divaMIDE-727MIDE727mide00727
    • 2020-01-10
    178 min

    [RIX-073]A Hawaiian Men's Massage Parlor A Place For Some Lomi Lomi Massage 3

  • censoredbig titsamateurRIXprestigerelaxation roomRIX-073RIX073118rix00073
    • 2020-01-09
    52 min

    345SIMM-339 [Beautiful ass] Inevitable repeater! Popular spanist massage tech [beautiful legs]

  • amateur censoredcreampieamateursimmsimm-339simm339345simm-339
    • 2019-12-13
    196 min

    [RIX-072]Beautiful Working Marrie Woman's First-Rate Rejuvenating Massage

  • censoredbig titsamateurRIXprestigerelaxation roomRIX-072RIX072118rix00072
    • 2019-12-01
    116 min

    [NACR-286]A Cuckold Husband Wants To See His Wife Get Fucked By Her Massage Therapist - Hana Shirosaki

  • white flowers censoredcreampiesingle workNACRplanet plusbirdman teppeinanakuruNACR-286NACR286h-237nacr00286
    • 2019-11-23
    149 min

    [HUSR-198]If This Super Beautiful Massage Therapist Who Has A Sterling Reputation In Her Home Of South Korea Is Getting Cunnilingus Until Her Pussy Gets Musty, Will She Be Unable To Resist The Pleasure So Much That She'll Have Sex!？

  • censoredamateurHUSRbig morkalbooker thussleHUSR-198HUSR19857husr00198
    • 2019-11-08
    186 min

    [RIX-071]Streaming Peeping Video Of Repressed Tempting And Provoking Masseuse!!

  • censoredbig titsamateurRIXprestigerelaxation roomRIX-071RIX071118rix00071
    • 2019-11-01
    241 min

    [BUR-535]Whether You Can Fuck Her Or Not Is Up To You! Sexual Negotiations With A Pushover Massage Parlor Therapist Peeping Videos 4 Hours

  • censoredcreampiebig titsBURglay zburst graceBUR-535BUR53512bur00535
    • 2019-10-26
    118 min

    [WANZ-902]Neo G-Spot Development You'll Cum Just From Some Lower Abdomen Shiatsu Massage! An Out-Of-Body Deep Orgasmic Sex Experience Sora Shiina

  • shiina sky censoredcreampiesingle workWANZones factorywanzWANZ-902WANZ902wanz00902
    • 2019-10-11
    188 min

    [RIX-070]Feels So Good, It Will Put Anyone Into A Deep Sleep A Waterless Head Spa Massage Peeping Videos

  • censoredbig titsamateurRIXprestigerelaxation roomRIX-070RIX070118rix00070
    • 2019-09-28
    225 min

    [CLUB-580]Specializing In Beautiful Office Ladies Located In Nakano Ward This Clinic Promises To Treat Their Patients' Sensual Spots And Guarantees Ecstatic Pissing Pleasure 4

  • censoredsquirtingCLUBhentai shinshi clubCLUB-580CLUB580club00580
    • 2019-09-13
    236 min

    [RIX-069]Private Room Schoolgirl Sexual Massage Peeping 3

  • censoredamateurbeautiful girlRIXprestigerelaxation roomRIX-069RIX069118rix00069
    • 2019-09-10
    124 min

    [STARS-121]Tina Nanami Testicle Vacuum Suck Massage Parlor

  • nanami tina censoredslutsingle workSTARSsod createdragon nishikawasod starSTARS-121STARS1211stars00121
    • 2019-08-31
    184 min

    [CLUB-575]All Peeping I Got Friendly With A Beautiful Married Woman Who Lived In My Building And So One Day I Brought Her To My Room And I Fucked Her Brains Out Chapter Four 35

  • censoredcreampiemarried womanCLUBhentai gentleman clubCLUB-575CLUB575club00575
    • 2019-08-31
    237 min

    [CLUB-577]The Total Domain Of Girls In Uniform And Knee-High Socks They Giving Me A Dirty Talk Footjob And Forced Me To Cum Over And Over Again.

  • censoredCLUBhentai shinshi clubCLUB-577CLUB577club00577
    • 2019-08-09
    231 min

    [RIX-068]The UV Treatment Oil Salon Where Beautiful Girls In Bikinis Stop By On The Way Home From Swimming At The Beach 2

  • censoredbig titsamateurRIXprestigerelaxation roomRIX-068RIX068118rix00068
    • 2019-07-25
    70 min

    [GEKI-040]Shiori Is A Real-Life Massage Therapist Who Can Help You Cum Twice As Much And Twice As Long Through Her Testicles-Stimulating Massage Skills And Pull Out Teasing Technique To Bring You To 100ml Semen Creampie Glory (24 Years Old) Shiori Ku

  • kuraki bookmark censoredcreampieGEKIsuper rare amateurpeace makerGEKI-040GEKI040geki00040
    • 2019-07-12
    230 min

    [RIX-067]Business Hotel Business Trip Massage Voyeur 4

  • censoredbig titsRIXprestigerelaxation roomRIX-067RIX067118rix00067
    • 2019-07-05
    245 min

    [DNW-040]After She Puts On Her Uniform 9

  • censoredcreampiebig titsDNWprestigedocument nowDNW-040DNW040118dnw00040
    • 2019-07-04
    151 min

    [SSNI-511]Thin Curvy Teen And Filthy Stretch Shop, Rikka Inui

  • dry censoredsquirtingsingle workSSNIs1 no 1 stylerakudaSSNI-511SSNI511ssni00511
    • 2019-07-01
    120 min

    [SCR-221]A Private Salon Posting Video 2 - We Wanted To See If This Body Clinic With A 100 Repeat Rate Would Let Us Fuck, But That All Depends On You -

  • censoredcreampieblowjobSCRglay zs crimeSCR-221SCR22112scr00221
    • 2019-06-29
    178 min

    [CLUB-564]All Peeping I Got Friendly With A Beautiful Married Woman Who Lived In My Building And So One Day I Brought Her To My Room And I Fucked Her Brains Out Chapter Four 34

  • censoredbig titsCLUBhentai shinshi clubCLUB-564CLUB564club00564
    • 2019-06-14
    129 min

    [RIX-066]Couple Simultaneously Cheating On Each Other While Getting a Massage

  • censoredbig titsamateurRIXprestigerelaxation roomRIX-066RIX066118rix00066
    • 2019-06-07
    262 min

    [DNW-036]I Forgot To Turn Off These POV Videos 9

  • censoredcreampiebig titsDNWprestigedocument nowDNW-036DNW036118dnw00036
    • 2019-05-10
    206 min

    [RIX-065]A Hawaiian Men's Massage Parlor A Place For Some Lomi Lomi Massage 2

  • censoredbig titsamateurRIXprestigerelaxation roomRIX-065RIX065118rix00065
    • 2019-05-01
    121 min

    [SCR-217]Complete Private Salon Fucking Creampie Secret Connection Filthy Peeping 1

  • censoredcreampieblowjobSCRglay zs crimeSCR-217SCR21712scr00217
    • 2019-04-27
    195 min

    [CLUB-557]An Immoral Doctor Who Targets Girls In Uniform Is Giving Nipple Tweaking Medical Examinations 4

  • censoredbig titsCLUBhentai shinshi clubCLUB-557CLUB557club00557
    • 2019-04-26
    126 min

    [DTT-020]A Busty Wife Who Doesn't Know How Hot She Is. A Tall Married Woman With G-Cup Tits, Tsukasa Izumi, 30 Years Old. Porb Debut!! 168cm Tall, 93cm Bust. A Slender Body With Beautiful Big Tits

  • tsukasa izumi censoredbig titssingle workDTTprestigesamantha tabatakanbiDTT-020DTT020118dtt00020



    • Japan xxx, japanese adult videos, japani sexy, Japanese Adult Movies, JAV censored, Japanese tube, Japanese sex online