javcensored gonzo censored shaved pussy amateur




FC2BBANFSDSSADNAUKGPPPDSSISMIAADTTCESDSQTEAVSAEBODCJODJULAUKSCHRVLULUMILKHZGDGVH

2020-11-10
59 min

HEYZO 2394 Naked Housewife’s Lewd Private Life Vol.3 – Chino Ogata

  • chino ogata uncensoredcreampieheyzo
    • 2020-11-13
    92 min

    [XRW-944]How To Turn An Office Lady Picked Up From A Dating Site Into Your Fuck Buddy Through Sex Management: The Kaede Case - Kaede Ito

  • kaede ito censoredblowjobsingle workXRWreal worksreal real worksXRW-944XRW944172xrw00944
    • 2020-12-22
    120 min

    [MSB-002]Fucking Another Man's Wife And Giving Her A Raw Creampie 3! 2 Years Married / Living In Meguro, Tokyo / 1 K*d / Even Though It's Her Ovulation Day, Housewife Madoka Takes The Dick Raw And Screams And Moans As She Gets Fucked Deep And

  • amateur censoredcreampiemarried womanMSBfutureMSB-002MSB002
    • 2020-12-25
    240 min

    [MBM-252]A Plain Jane Mature Woman And Her Selfish Body! This Old Lady Lives Humbly And Never Draws Attention To Herself, But When She Takes Off Her Clothes, She's Got A Super Erotic Body, And What A Difference! She's So Damned Sexy! Your Coc

  • censoredcreampieamateurMBMprestigegaro sasazukambmMBM-252MBM252118mbm00252
    • 2021-01-01
    117 min

    [NACR-387]Hold Me, Lover... I Fell In Love With The Single Mother Living Next Door Risa Mochizuki

  • risa mochizuki censoredcreampiemarried womanNACRplanet plusdirector oshichidomeNACR-387NACR387h-237nacr00387
    • 2021-01-01
    56 min

    324SRTD-0205 Forbidden video of a girl for the purpose of compensated dating with a perverted uncle and raw squirrel, raw vaginal cum shot

  • amateur censoredcreampieamateursrtdsrtd-0205srtd0205324srtd-0205
    • 2021-01-09
    119 min

    [DASD-793]I Hate Men, But I Love Cocks. Lesbian Fallen For A Tall Beauty's Clit-Dick

  • makino shion yui hatano censoredlesbiandramaDASDdasrokusaburo mishimaDASD-793DASD793dasd00793
    • 2021-01-09
    118 min

    [MEYD-649]If You Can't Make The Rent You're Welcome To Pay It With Your Wife's Body. Kyoko Maki

  • maki kyoko censoredcreampiebig titsMEYDtameike gorohirokoji osakiMEYD-649MEYD649meyd00649
    • 2021-01-12
    46 min

    FC2PPV 1641718 There are benefits! [Personal shooting] JD cosplayer Mone-chan’s real face was a slut …!

  • amateur uncensoredfc2
    • 2021-01-15
    486 min

    [MTM-019]Street Corner Amateur Pick-Up! A Hot Housewife Gets Picked Up. Raw Creamie Best-Of 8 Hours vol. 01

  • censoredcreampieMTMprestigemegatra maxMTM-019MTM019118mtm00019
    • 2021-01-16
    120 min

    [PPPD-901]My Son Is In An Illicit Relationship With His Homeroom Teacher He's Getting Conveniently Free Pussy From That Big TIts Bitch And Creampie Ejaculations Galore Miku Maina

  • maina miku censoredcreampiebig titsPPPDoppaiPPPD-901PPPD901pppd00901
    • 2021-01-16

    H0930 ki210116 Self Shot

  • amateur uncensoredh0930
    • 2021-01-24
    115 min

    [HYBR-010]School Report: The Hottest Girl On Campus Is Actually A Cross-Dresser Ai Sato ri

  • airi sato censoredschoolgirlsingle workHYBRhybrid films daydream tribedavielHYBR-010HYBR010hybr00010
    • 2021-02-11
    135 min

    [SW-756]I Like Older Men. My Friend's Little Sister Was Totally My Type, And She Was The Kind Of Sch**lgirl Who Loved To Lure Men To Temptation! She Got Me Hot And Hard With Her Total Domain Of Knee-High Socks, And Tempted Me With Her Sweet Voice

  • kagami sara censoredschoolgirlsingle workSWswitchSW-756SW7561sw00756
    • 2021-02-15
    150 min

    [WA-449]I Was Pussy Grinding My MILF Stepmama When She Said, "Oh! Your Rock Hard Cock Slipped Inside Me!" But It Felt So Good We Just Kept On Going In The Raw! 2

  • censoredmilfmature womanWAlotusWA-449WA449h-047wa00449
    • 2021-02-17
    48 min

    [sika-033]明日香(27)

  • amateur censoredamateurblowjobsikasika-033sika033sika-033
    • 2021-02-18
    14 min

    Caribbeancom 021821-001 Pussy Encyclopedia : Akari Satsuki

  • akari satsuki uncensoredcaribbeancom
    • 2021-02-26
    72 min

    [opcyn-157]ともこ(19)

  • amateur censoredbig titsamateuropcynopcyn-157opcyn157opcyn-157
    • 2021-02-26
    121 min

    [SGM-050]New: Beautiful Mature Woman Bathhouse - High Class Bathhouse - Iku Kondo

  • satoshi kondo satomi kondo censoredcreampiebig titsSGMglobalyayoi nakanosuperSGM-050SGM050143sgm00050
    • 2021-03-01
    153 min

    [DOKS-537]New - Sexually Frustrated Wives Watch People Jack Off No. 4

  • censoredamateurblowjobDOKSofficeDOKS-537DOKS53736doks00537
    • 2021-03-05
    118 min

    [ONEZ-278](Totally POV) Instant Sucking, Quickie Sex! You Have A Pregnancy Fetish？ OK! A Shameful Maid Who's Ready To Impregnate Kanna Shiraishi

  • shiraishi plane censoredcreampieblowjobONEZprestigeonezONEZ-278ONEZ278118onez00278
    • 2021-03-05
    68 min

    [KYUN-009](For Streaming Editions) # So Cute 009 / Kanon / 19 Years Old / College S*****t Kanon Ibuki

  • kanobuki censoredbig titsbeautiful girlKYUNprestigekyunKYUN-009KYUN009118kyun00009
    • 2021-03-18
    149 min

    [PPPD-913]A Big Tits Maid Came To My Place (I'm A Dirty Old Man With A Play Room) She Gave Me Baby Dirty Talk And Nursing Handjob Action And Spoiled Me Rotten With Baby Play Sex Games Tomoko Kamisaka

  • tomoko kamisaka censoredbig titsbeautiful girlPPPDoppaiPPPD-913PPPD913pppd00913
    • 2021-03-20
    239 min

    [TKBN-024]Raw Instinct Adultery Trip - Formerly Famous Actress Edition

  • kazama yumi yuki misa censoredTKBNstar paradisetreasure shipTKBN-024TKBN024h-254tkbn00024
    • 2021-03-30
    115 min

    [RD-1046]Mature Wives - Housekeeper In Her Fifties Falls Prey To Her Employer - Mourning Wife Ravished By Her Brother-In-Law On The Morning Of Her Husband's Funeral

  • yori sorami sanada sanako censoredmarried womanblowjobRDathena videomurayamaathenaRD-1046RD1046149rd01046
    • 2021-04-17
    120 min

    [CAWD-203]"There's Not A Single Day I Don't Remember" Meeting Up With Your Girlfriend In A Long Distance Relationship After One Whole Month Without Sex - Creampie After Passionate Creampie Yui Amane

  • amane yui censoredcreampiebeautiful girlCAWDkawaiiinaballCAWD-203CAWD203cawd00203
    • 2021-04-17
    193 min

    [JUL-545]Surprise Transfer Madonna Exclusive Kana Yume Hot And Steamy Adult Kisses Dripping With Spit 3 Video Special

  • kana yui censoredmature womansingle workJULmadonnamametaro mamezawaJUL-545JUL545jul00545
    • 2021-04-23
    116 min

    [WAAA-055]Licking The Cock Head While Giving A Boob Job At The Same Time Dripping With Spit Slut Licks The Whole Cock Honoka Tsujii

  • tsujii honoka censoredbig titsslutWAAAwanz factorywanzWAAA-055WAAA055waaa00055
    • 2021-04-29
    65 min

    SIRO-4410 [First shot] [Beautiful buttocks with soft skin] A 19-year-old cafe clerk with beautiful breasts and pure white ass appears. If the sensitivity of teenage smooth soft skin also increases, it will attract the heat .. AV application on the ne

  • amateur censoredamateursirosiro-4410siro4410siro-4410
    • 2021-05-01
    120 min

    [NACR-418]I Was Domesticated By My Father-In-Law Natsu Tojo

  • natsu tojo censoredcreampiesquirtingNACRplanet plusbito sakurananakuruNACR-418NACR418h-237nacr00418
    • 2021-05-08
    127 min

    [DPMX-016]Celebitch! Clothed Temptation - Nozomi Mare

  • nozomi nozomi censoredsingle workDPMXavs collector sdopamixavscollector sDPMX-016DPMX016dpmx00016
    • 2021-05-18
    63 min

    FC2PPV 1824407 A figure that should not be seen by women with gorgeous occupations. First shot SEX with vaginal cum shot.

  • amateur uncensoredfc2
    • 2021-06-12
    141 min

    [USAG-031]The Sisterly Type. Hikaru (19) Tanned Gal / Hard Thrusting / Super Sweet / Shaved Pussy / Hot Ass / Creampie Sex / 3 Full Fucks / Pov / Three-Some / You'd Never Guess How Slutty She Is

  • censoredUSAGrabbit daydreamersUSAG-031USAG031usag00031
    • 2021-06-16
    125 min

    [GVH-246]Naughty Nurses Satomi Suzuki

  • satomi suzuki censoredcreampiegrandfatherGVHglory questham the mcGVH-246GVH24613gvh00246
    • 2021-06-25
    66 min

    SIRO-4558 [First shot] [Innocent] [Super beautiful legs x small nice ass] A slender beautiful girl who sticks out her small nice ass to the camera and fascinates her desperate look. Serious sex of active college students is the main story! AV applica

  • amateur censoredamateursirosiro-4558siro4558siro-4558
    • 2021-07-09
    236 min

    [MUKD-464]A make-belief feel-good brothel where innocent yet naughty barely legal girls give you handjobs and blowjobs with smiles on their faces! Rubbing your hot, throbbing dick, with their wet pussies, these 10 girls will make you cum for 240 minu

  • censoredschoolgirlamateurMUKDmukuMUKD-464MUKD464mukd00464
    • 2021-07-10
    217 min

    [BAZX-298]Thick Sex With A Widow In Mourning Dress vol. 004

  • censoredcreampieBAZXbazookatodoBAZX-298BAZX298bazx00298
    • 2021-07-17
    102 min

    355OPCYN-171 Karen Asahina Karen

  • amateur censoredcreampiemarried womanopcynopcyn-171opcyn171355opcyn-171
    • 2021-07-29
    121 min

    [TOEN-046]Sexually Frustrated Stepmom Becomes Addicted To Sex With Her Stud Stepson During The Three Days Her Husband Is Out Of The House And They Fuck Day And Night For 72 Hours Straight Tsubaki Kato

  • kato camellia censoredcreampiemarried womanTOENcenter villageyoichi sanotaoyuanTOEN-046TOEN046h-086toen00046
    • 2021-08-06
    138 min

    [HODV-21594]For My Use Only! Fucking Sluts Who Have Colossal Tits: Mating With, And Raising, As I Like Colossal Tits Girls Who Run Away From Home. Riina Asuka.

  • asuka riina censoredcreampiebig titsHODVh m pbottomsHODV-21594HODV215945642hodv21594
    • 2021-08-07
    169 min

    [SCPX-430]Teeny Tiny Micro-Bikini And Lotion Makes A Hot Amateur Cutie Blush - It Was Supposed To Be Thigh Sex But She Was So Slippery The Cock Slipped Right In! "I Said Not To Stick It In Me..." But Her Request Is Ignored And Results In A Ho

  • censoredcreampiebig titsSCPXk m producescoop kmpSCPX-430SCPX430scpx00430
    • 2021-08-13
    121 min

    [MVSD-477]Teacher ! You"re Sucking Too Much! The Cute Teacher Mitsuki"s Cheering Vacuum Blowjob! Mitsuki Hirose

  • mitsuki hirose censoredcreampieblowjobMVSDm s video groupms video groupMVSD-477MVSD477mvsd00477
    • 2021-08-17
    41 min

    361SEKAO-160 Chuhi From South Korea

  • amateur censoredbig titsamateursekaosekao-160sekao160361sekao-160
    • 2021-08-30
    45 min

    FC2PPV 2106715 [Face Exposure] A Beautiful Hairless Beauty. She Commits A Stupid Female Toy With A Large Number Of Employees And Makes Vaginal Cum Shot.

  • amateur uncensoredfc2
    • 2021-09-02
    124 min

    [JRZE-074]First Time Filming My Affair, Yumika Towa

  • fujiwa yuka censoredcreampiemature womanJRZEcenter villageminatoyashoku ureJRZE-074JRZE074h-086jrze00074
    • 2021-09-04
    110 min

    [ANB-194]Beautiful and Erotic Aunt Gets Me Rock Hard With Her Lewdness, Starring Anna Nose

  • anna ichinose censoredsquirtingmature womanANBrubyyanoguchi susumunobleANB-194ANB194anb00194
    • 2021-09-09
    135 min

    [HBAD-595]Beautiful Big Tits Nurse Want Her Patients To Be Happy With Her Sexual Favors Rina Takase Rina Takase

  • rina takase censoredbig titssingle workHBADhibinorokutanzono seishibabeHBAD-595HBAD5951hbad00595
    • 2021-09-14
    82 min

    H0930 ki210914 Kyouko Ishinuki 27years old

  • amateur uncensoredh0930
    • 2021-09-15
    481 min

    [RVG-141]Mom"s Real Sex Education Best Hits Collection vol. 7

  • yuri chitose mika ichijo censoredmilfdramaRVGglory questRVG-141RVG141rvg00141
    • 2021-09-17
    268 min

    [360MBMS-016]素人ホイホイ×MBM 衝撃の透明感 純度1万の笑顔 ホンモノ天使ちゃん3連発 02 撮り下ろし 268分

  • amateur censoredamateurbeautiful girlmbmsmbms-016mbms016360mbms-016
    • 2021-09-18
    104 min

    500DPL-0035 Tall Beautiful Legs Former Cram School Lecturer CAR Sex Yuno Hirase

  • amateur censoredamateurdpldpl-0035dpl0035500dpl-0035
    • 2021-09-23
    101 min

    [SPRD-1463]Stepmom Seduced By Horny Stepson Ryouko Izumi

  • ryoko izumi censoredmature womansingle workSPRDtakara eizoutsukumo kyuutaaleddinSPRD-1463SPRD146318sprd01463
    • 2021-09-28
    95 min

    355OPCYN-181 Riku

  • amateur censoredbig titsamateuropcynopcyn-181opcyn181355opcyn-181
    • 2021-10-01
    122 min

    [NACR-471]Drenched By A Sudden Rainstorm ... My Favorite Private Tutor Couldn"t Find Her Way Home Reona Tomiyasu

  • takehiro tomiyasu censoredbig titssingle workNACRplanet plushimurokkushichi ku ryuuNACR-471NACR471h-237nacr00471
    • 2021-10-16
    120 min

    [C-2674]Wife"s Friend Ended Up Staying At Our Place, It Seemed Natural For Me To Move On "Married Woman Mrs. Namie (Stage Name) 32 Years Old" (12)

  • censoredmature womanCgo go zutakahashi kouichigogos coreC-2674C2674
    • 2021-10-22
    120 min

    [JUL-746]A Married Woman Secretary, Immersed In Sweat And Kisses, Having Creampie Sex In The President"s Office She"s A Sexual "Genius." A Super Massive Fresh Face Discovery And Here She Is, Making Her Appearance In The <Secretary&g

  • minami ahn censoredcreampiebig titsJULmadonnanagaeJUL-746JUL746jul00746



    • Japan xxx, japanese adult videos, japani sexy, Japanese Adult Movies, JAV censored, Japanese tube, Japanese sex online