javcensored amateur censored nampa creampie




FC2SDABSPRDHDKASSNIDTTFSDSSAWDVEMASTARSMILKKSBJMARAIPXSQTEATIDCAWDMVSDHZGDDASDGMEM

2020-12-10
21 min

FC2PPV 1601701 [No] I gave a vaginal cum shot at the age of 20 aiming for the title of a diploma

  • amateur uncensoredfc2
    • 2020-12-11
    239 min

    [SOUD-018]Give Beautiful Teens Dressed Up As Santa's Helpers Their White Christmas! Picking Up Girls To Pump Them Full Of Jizz

  • censoredamateurcosplaySOUDprestigebest fuckingSOUD-018SOUD018118soud00018
    • 2020-12-27
    240 min

    [MCST-004]Rough Sex Fuck

  • censoredcreampieschoolgirlMCSTmercurystrawberryMCST-004MCST004h-1133mcst00004
    • 2020-12-31
    160 min

    [BF-624]I Moved Towns For Work And Now My Landlord's Wife Is Trying To Seduce Me - I Ended Up Giving Her My Creampie... Ai Mukai

  • ai mukai censoredcreampieslutBFbefreeroku yonBF-624BF624bf00624
    • 2021-01-08
    14 min

    FC2PPV 1636662 De М video! Premature ejaculation and intensely bright Paris Pigal Bitch is ruined and encouraged

  • amateur uncensoredfc2
    • 2021-01-09
    118 min

    [MIMK-081]Wet See-through Shirt, Fucked While Sheltering From The Rain - Sachiko

  • sachiko censoredcreampiebig titsMIMKmoodyzmametaro mamezawamankitsuMIMK-081MIMK081mimk00081
    • 2021-01-29
    77 min

    [fan-104]あいか

  • amateur censoredcreampiebig titsfanfan-104fan104fan-104
    • 2021-01-31
    50 min

    493PKPD-080 [Odorless] Make a female K student squid with a big cock! Convulsions climax hell

  • amateur censoreduniformamateurpkpdpkpd-080pkpd080493pkpd-080
    • 2021-02-04
    47 min

    FC2PPV 1672335 Until 11 1480 [No] Black-haired slender beautiful girl. She is sanctioned and her life ○ vaginal cum shot without escape.

  • amateur uncensoredfc2
    • 2021-02-11
    207 min

    [SW-755]These Big Ass Voluptuous Housewives From The Neighborhood Were Flashing Their Pantyhose And Panty Shot Action At Me! They Were Secretly Horny Bitches Who Got Excited From Being Watched! Well, If They're Just Waiting To Get Fucked, Then I&

  • censoredSWswitchyocchanSW-755SW7551sw00755
    • 2021-02-12
    119 min

    [JUFE-257]Dense Licking Sexual Intercourse, Dripping Juices While Staring At A Man - Karen Usui

  • usui ren censoredsquirtingblowjobJUFEfitchJUFE-257JUFE257jufe00257
    • 2021-02-26
    238 min

    [ASI-031]A Married Woman's First-time Shots - I Will Fuck A Married Woman In POV Now.

  • censoredbig titsamateurASIprestigekanbiASI-031ASI031118asi00031
    • 2021-03-01
    300 min

    [DKSB-108]Do Chicks Love Dicks？! Picking Up Girls - We Showed 30 Hot Babes A Full Erection To See If They'd Get Horny, And Oh Boy Did They Ever! You Won't Believe What They Wanted To Do. 5-Hour Special

  • censoredamateurblowjobDKSBoffice k sks bestDKSB-108DKSB10836dksb00108
    • 2021-03-02
    58 min

    C0930 ki210302 Midori Kimishima 23years old

  • amateur uncensoredc0930
    • 2021-03-03
    46 min

    362SCOH-043 [Creampie] Let a carefully selected beautiful girl cosplay and conceive my child! [Junko Enoshima]

  • amateur censoredbig titsuniformscohscoh-043scoh043362scoh-043
    • 2021-03-05
    81 min

    [FTSH-003]Asses Abound! H[

  • amateur censoredFTSHorustak softFTSH-003FTSH003
    • 2021-03-13
    145 min

    [JUFE-266]Your Lady Boss Will Gently Scold You With Panty Shot Dirty Talk A Filthy Human Resources Development Program To Manage A Bad Employee's Ejaculations Ren Usui

  • usui ren censoredslutsingle workJUFEfitchJUFE-266JUFE266jufe00266
    • 2021-03-15
    362 min

    [YPTS-003]True Stories! Sugar Daddy Insertion: Amateur POV Leaked Pictures 2

  • censoredcreampiebig titsYPTSpetersYPTS-003YPTS003h-021ypts00003
    • 2021-03-24
    62 min

    SIRO-4467 [First shot] [Professional student injured] [Begging with a shameful face] "I can’t even watch a romance movie .." 20-year-old young body is an adult technique .. AV application on the net → AV experience shooting 1490

  • amateur censoredsquirtingamateursirosiro-4467siro4467siro-4467
    • 2021-03-28
    58 min

    H0930 tk0031 Kanna Noi 34years old

  • amateur uncensoredh0930
    • 2021-03-31
    57 min

    292MY-454 Honda Minami 2

  • amateur censoredcreampiemarried womanmymy-454my454292my-454
    • 2021-04-11
    21 min

    FC2PPV 1764098 [4K] [Individual shooting] Non-chan, 19 years old, who lives in Tokyo.

  • amateur uncensoredfc2
    • 2021-04-14
    216 min

    [HUNTA-990]I Caught Two Of My Hottest Female Coworkers Making Out! They Were Kissing And Fucking Passionately, And When They Saw Me, They Let Me Join Them! After Our Work Party Was Over, The Two Of Them Brought Me Home, Too...

  • censoredcreampielesbianHUNTAhuntervolvo nakanohhh groupHUNTA-990HUNTA990hunta00990
    • 2021-04-17
    175 min

    [CAWD-211]Real Life College Girl With A Bright Smile Nozomi Kitajo 19 Years Old Kawaii* Exclusive Debut

  • nozomi kitajo censoredsquirtingbeautiful girlCAWDkawaiikyoseiCAWD-211CAWD211cawd00211
    • 2021-04-28
    56 min

    10musume 042821_01 An amateur girl challenges the game for prizes! Punishment game is creampie sex Anna Shirosaki

  • amateur uncensored10musume
    • 2021-04-29
    72 min

    200GANA-2479 Seriously Nampa, first shot. 1628 Picking Up Female College Students Who Are Job Hunting Called Interviews! Drink and bring them to the hotel and play with each other … If you notice, break the pantyhose and enjoy the big ass! You c

  • amateur censoredamateurganagana-2479gana2479200gana-2479
    • 2021-05-21
    119 min

    [HND-994]Multiple Creampie Brothel Where You Can Fuck The Girls Raw As Much As You Want Hana Himesaki

  • himesaki hana censoredcreampiebig titsHNDhon nakazaku araiHND-994HND994hnd00994
    • 2021-06-04
    63 min

    520SSK-003 Haruka

  • amateur censoredcreampieuniformsskssk-003ssk003520ssk-003
    • 2021-06-10
    43 min

    C0930 ki210610 Atsuko Kiyono 47years old

  • amateur uncensoredc0930
    • 2021-06-19
    115 min

    [CAWD-229]S********l In Uniform Bred By 48 Raw Loads By A Smelly Older Man In Her Neighbor's Garbage-Strewn Room... Yumeru Kotoishi

  • yume kotoishi censoredcreampieuniformCAWDkawaiiCAWD-229CAWD229cawd00229
    • 2021-06-20
    125 min

    [NDWQ-011]Deepthroat Demon Breaking In: Female Body Reverse Fluid Injection Edition - Makoto Kawagoe

  • makoto kawagoe censoredcreampiesquirtingNDWQtoyohikozarakiseiunkai ekusutorimuNDWQ-011NDWQ011ndwq00011
    • 2021-06-24
    207 min

    [SW-784]"You Can't Fall In Love With Any Other Girls, Only Me! S********l Suddenly Pays A Surprise Visit To My House Where I'm Living Alone! And For Some Reason She's Totally In Love With Me Acting All Clingy And Kissy! Before I Know

  • narita tsumugi censoredsingle workSWswitchraito fuji makotoswitch hibinoSW-784SW7841sw00784
    • 2021-07-02
    79 min

    518ASGM-009 [Sleep Fucking / Intravaginal Ejaculation] Shinagawa Ward Glasses Beautiful Girl Hidden Camera (Tokyo / International Studies) Estimated F Cup

  • amateur censoredcreampiebig titsasgmasgm-009asgm009518asgm-009
    • 2021-07-07
    63 min

    FC2PPV 1909531 ☆ First shot ☆ Complete appearance ☆ Fair-skinned mochi skin de M beautiful girl ♥ When the switch is turned on even though it is quiet, "No! ♪ I’ve done it until the second round ♥ [Individual

  • amateur uncensoredfc2
    • 2021-07-08
    83 min

    [REBD-568]Yura 6: Swaying And Fresh - Yura Kano

  • yura kanno censoredREBDrebeccariverREBD-568REBD568h-346rebd00568
    • 2021-07-28
    420 min

    GWARA-002 [Limited Time Sale] [Mgs Exclusive Distribution Best] Sex Talent Vol.02 Carefully Selected 20 People Carefully Selected Recording 7 Hours Special

  • amateur censoredamateurgwaragwara-002gwara002gwara-002
    • 2021-08-12
    128 min

    [IENF-157]S********ls From A Famous Prep School See A Guy Jerk Off For The First Time! Watching Up Close, Their Pussies Throb As They Watch Him Precum And Hear Him Fap! They Blush And Ask For Raw Cock And Get A Creampie!

  • karen nanase jinno hina censoredcreampieschoolgirlIENFie nergytaiga kosakaiienfIENF-157IENF1571ienf00157
    • 2021-08-21
    57 min

    H4610 ki210822 Chika Yoshimoto 33years old

  • amateur uncensoredh4610
    • 2021-09-02
    117 min

    [MILK-119]The Married Woman Next Door Has A Voluptuous, Sexy Body, And I Had Such A Pregnancy Fetish For Her That During The 48 Hours That She Was Highly Impregnable, While Her Husband Was Away, I Fucked Her Brains Out, And Here Is The Entire Video R

  • akari shinmura censoredbig titsslutMILKmilkMILK-119MILK119h-1240milk00119
    • 2021-09-09
    159 min

    [SW-797]My Classmate First Love With Big Tits And My Female Teacher With A Big Ass Meet At The Class Reunion To Fuck! 10 Years Later She Is a Married Woman With A Curvy Ass And Tits, Now I"m Too Hard And She"s Working My Dick At The Store, Ho

  • censoredbig titsSWswitchyocchanswitch hibinoSW-797SW7971sw00797
    • 2021-09-17
    30 min

    FC2PPV 2212749 * Super Deals Limited To Consecutive Holidays 980 Yen! * 19-Year-Old [Shimbashi_hospital Receptionist] Cosplay Student Support 〇

  • amateur uncensoredfc2
    • 2021-09-20
    140 min

    [VNDS-5216]Mature Women Hitomi Katase

  • hitomi katase censoredcreampieblowjobVNDSstar paradisenext11VNDS-5216VNDS5216h-254vnds05216
    • 2021-09-25
    241 min

    [SGSR-286]Town Amateur College Girl Channel, Super Cute College Gal Looking For Work Yells "Don"t Look!" But Take Me To A Hotel! Being Real Is Important In Both Job Hunting And Fucking! 4 Hours 14 Women

  • censoredcreampieamateurSGSRbigmorkalshin sen kumiSGSR-286SGSR28657sgsr00286
    • 2021-10-02
    243 min

    [MMB-388]Amazing Nerdy Beautiful Y********l In Uniform 10 Girls, I Usually Don"t Read, But When I Went To The Library To K**l Time, I Ended Up Fucking An Erotic Nerdy Beautiful Y********l In Uniform Who Loves Books Raw For A Creampie

  • mari takasugi arisaka miyuki censoredcreampieuniformMMBmomotarou eizou shuppanishikiribashi hakasemomotaro bestMMB-388MMB388mmb00388
    • 2021-10-10
    87 min

    345SIMM-669 [Uncle All Drink J ○] A Serious Student Council President At School! Nacchan, A Nympho School Girl Who Cums Herself For Semen When She’S Alone With Her Uncle W I Met Nacchan Who Is Busy Preparing For The School Festival After A Long

  • amateur censoredcreampiesquirtingsimmsimm-669simm669345simm-669
    • 2021-10-14
    60 min

    C0930 ki211014 Yoshino Sasahara 39years old

  • amateur uncensoredc0930
    • 2021-10-15
    99 min

    277DCV-192 Is It Okay To Send It Home？ Case.186 [* Be Careful Of Eardrum Explosion! Gasping Voice Max! It’s Too Masochistic And Full Of Highlights Sp] ⇒ Strangling Iki, Nipple Iki, Iramaiki, Just Sweaty And Crazy Iki! Gakuburudo M Makai! ⇒ Perfe

  • amateur censoredsquirtingamateurdcvdcv-192dcv192277dcv-192
    • 2021-10-20
    481 min

    [RVG-144]The Sexy PTA Director And The Bad Boy S*****t Council President BEST vol. 7

  • yuri sugawa honoka takikawa censoredRVGglory questRVG-144RVG144rvg00144
    • 2021-10-20
    60 min

    Caribbeancom 102021-001 Quick Shooting: The Best Of Mai Yoshino

  • mai yoshino uncensoredcreampiehandjobcaribbeancom
    • 2021-10-29
    162 min

    [MIAA-521]The Absolute Aerial Domain She"ll Jam Your Cock Into Her Silky Smooth Cunt Crack And Between Her Thighs And Toy With You Because She"s A Devilish Barely Legal Babe Ichika Matsumoto

  • ichika matsumoto censoreduniformslutMIAAmoodyzmasaki naominna no kikatanMIAA-521MIAA521miaa00521
    • 2021-11-04
    69 min

    FCP-051 [Delivery Only] Completely Subjective! !! G Cup Or More That Completely Wraps Ji ● Ko … Superb Big Tits Fucking ＃ 5 (Saeko Hiiragi, Leona Fujisaki, Kanon Ibuki)

  • amateur censoredbig titsamateurfcpfcp-051fcp051fcp-051
    • 2021-11-14
    20 min

    10musume 111421_01 Beautiful Breasts Girl’s Service Fucking BJ Mei Misaka

  • amateur uncensored10musume
    • 2021-11-25
    66 min

    OREX-332 Fuwari (Hino fluffy)

  • amateur censoredcreampiebig titsorexorex-332orex332orex-332
    • 2021-12-03
    181 min

    [SHKD-981](Caution When Viewing) Trick Pick Up Ring. Ami Kitai

  • kiyo ami censoredbig titssingle workSHKDattackersshi yoru akuSHKD-981SHKD981shkd00981
    • 2021-12-24
    120 min

    [IBW-854]"I Came To See You, You Dirty Old Man ..." This Little Step Niece Loves Her Step Uncle Who Lives Out In The Country Lala Kudo

  • kudou rara censoredcreampiesoloworkIBWi b worksIBW-854IBW854
    • 2022-01-01
    135 min

    [OVG-189]Anal Masturbation OVG- 189

  • yurika rui hizuki censoredanalslutOVGglory questOVG-189OVG189ovg00189



    • Japan xxx, japanese adult videos, japani sexy, Japanese Adult Movies, JAV censored, Japanese tube, Japanese sex online