jav older sister high vision upskirt javcensored




FC2AVSANGODAUKGWAAAPPPDCJODHODVMIAAGVHGMEMHMNFSDSSPREDMIDVSSISSPRDDTTWANZNATRBLK

2022-01-13
201 min

[SW-821]Lewd Education For Older Step-sister. She"s All Grown Up Now With A Curvy Body, And She Gets A Big Lesson From A Hard Dick!

  • censoredbig titssisterSWswitchyocchanswitch switchSW-821SW8211sw00821
    • 2021-11-19
    236 min

    [HUNTB-147]"You Saw My Underwear Just Now, Right？" A Perverted Lady Tries To Give Me A Boner With A Suggestive Panty Shot That Has To be On Purpose With The Way She Spreads Her Legs

  • censoredcreampieslutHUNTBhuntermorikihhh groupHUNTB-147HUNTB147huntb00147
    • 2021-10-30
    131 min

    [MMUS-058]A Couple of Exciting Gals Who Are Temptresses. Sarina Momonaga, Himari Kinoshita

  • sarina momonaga himari kinoshita himari hanazawa censoredslutMMUSmarrionkasai kijinkcpMMUS-058MMUS058mmus00058
    • 2021-10-21
    137 min

    [PARM-169]Super Real!! Model Let Me Take Pictures Of Her Wet Panties

  • censoredbeautiful girlPARMaroma kikakumousou chirarizumuPARM-169PARM169parm00169
    • 2021-05-20
    158 min

    [DANDY-765]I'm On The Last Train Home, And To My Surprise, Me And This Slut Are The Only Ones On Board! She Was Sitting Across From Me, Flashing Panty Shot Action And The Temptation Of Her Beautiful Legs Gave Me A Serious Erection, And I Was Done

  • censoredslutDANDYdandybacon tanakaDANDY-765DANDY7651dandy00765
    • 2021-03-01
    140 min

    [PVT-017]Voluptuously Erotic Elder Stepsisters Will Lure You To Panty Shot Masturbation Temptation 2

  • censoredlingeriePVTsarutoru video publisherpink velvetPVT-017PVT017h-897pvt00017
    • 2021-02-28
    145 min

    [LULU-060]It's Late At Night At The Office, And I'm Alone, Working Overtime With My Married Woman Lady Boss! She Was Seated At Her Desk, Facing Me, Flashing Her Beautiful Legs And Panty Shot Action At Me, And When I Gave In To Her Temptation,

  • tsukino luna censoredcreampiesingle workLULUlunaticsluminaxLULU-060LULU060lulu00060
    • 2021-01-08
    108 min

    [ARM-941]If You're Going To Cum, Make Sure It's On My Tighs!

  • suzuka walnut sarina kurokawa censoredARMaroma planninghamu oujiaromaARM-941ARM941arm00941
    • 2021-01-01
    97 min

    [DOKS-533]Straddling Men's Faces To Show Off Their Panties & Pussy Gets Them Wet - Reverse Angle Masturbation

  • kasagi ichika mai takeda censoredschoolgirlDOKSoffice k sfechi nioffice ksDOKS-533DOKS53336doks00533
    • 2020-12-02
    131 min

    [ARM-928]Girls Cum By Rubbing Their Pussies On Men's Body Parts

  • nanako miyamura sakura miyuki censoredARMaroma planninghamu oujiaromaARM-928ARM928arm00928
    • 2020-11-13
    116 min

    [VRTM-520]"I'm Not Gonna Let You Cum!" - A Private Tutor In Knee Socks Does Cum Control On Her Cherry Boy S*****t! - She Makes Him Save It Up Until He's Ready To Explode, Then Finally Lets Him Cum Inside Her! 2

  • aishin shinkawa kurata mao censoredslutVRTMv r producegoro koenjiVRTM-520VRTM520h-910vrtm00520
    • 2020-10-17
    239 min

    [HUNTA-873]Hot Hard-Working Girls (Nurses, Teachers, Office Workers...) So Lost In Their Jobs That They Don't Notice They're Flashing Guys With A Panty Shot - And Getting Them Rock Hard!

  • censoredblowjobHUNTAhuntermorikihhh groupHUNTA-873HUNTA873hunta00873
    • 2020-10-14
    42 min

    [NYH-039]Her Sexy Bootie Got Me Hard With All Those Flashes Of Her Panties, So She Let Me Stick It In Her - Me And Miku Miku Abeno

  • miku abe censoredsingle workNYHdirectorsmeow meow houseNYH-039NYH0391nyh00039
    • 2020-10-14
    62 min

    [NYH-040]My Friend's Older Sister Lured Me To Temptation With Her Colossal Tits And Panty Shot Action Natsuko-san's Titties Natsuko Mishima

  • natsuko mishima censoredbig titssingle workNYHdirectorsmeow meow houseNYH-040NYH0401nyh00040
    • 2020-08-01
    239 min

    [HUNTA-823]"You Got Hard For Me？" "Oh No! I Might Wanna Fuck!？" My Friend's (Slut) Won't Stop Squeezing My Virgin Dick And Makes Me Creampie Her Over And Over!

  • censoredcreampieslutHUNTAhuntermorikihhh groupHUNTA-823HUNTA823hunta00823
    • 2020-06-27
    119 min

    [MIDE-795]Private Tutor Nao's "Creampie OK" Dirty Talk & Temptation Panty Shot Lesson - Nao Jinguji

  • jinguji temple nao censoredcreampieslutMIDEmoodyzdragon nishikawamoodyz divaMIDE-795MIDE795mide00795
    • 2020-06-14
    229 min

    [HUNTA-790]When I Went Home For The First Time In Years, I Found These Excessively Horny Ladies Waiting For Me, And They All Fucked Me, One After Another, Until I Was Drained! These Ladies Were Positively Too Erotic To Handle! I Could Tell From The W

  • censoredHUNTAhunterkawajirihhh groupHUNTA-790HUNTA790hunta00790
    • 2020-05-16
    154 min

    [ROYD-009]When I Spent All Night With My Severe And Skinny Big Tits Lady Boss, She Let Me Get An Exclusive Peek At Her True Self, And That Made Me Want Her For Myself. Yu Shinoda

  • shinoda yu censoredbig titssingle workROYDroyalkawajirihhh groupROYD-009ROYD009royd00009
    • 2020-05-02
    237 min

    [HUNTA-771]When I Moved To Tokyo, I Got An Apartment Located Only 5 Minutes From My Trade School, And I've Been Enjoying The Single Life! But Every Day, The Girls From Class Have Been Coming Over To Spend The Night... 2 It Was My First Time Livin

  • censoredblowjobHUNTAhunterkawajirihhh groupHUNTA-771HUNTA771hunta00771
    • 2020-04-11
    121 min

    [IPX-473]A Stepsister Shows Her Panties To Her Annoying Stepbrother - Tsumugi Akari

  • akari tsumugi censoredcreampiesingle workIPXidea pocketk westdishIPX-473IPX473ipx00473
    • 2020-04-04
    229 min

    [HUNTA-755]"Fine, I'll Sleep With You Today. I'll Make You Feel Better! But It's Just For Today!" When I Got Home After Being Dumped...

  • censoredcreampieHUNTAhuntermorikihhh groupHUNTA-755HUNTA755hunta00755
    • 2020-03-13
    120 min

    [VRTM-488]"I'm Not Gonna Let You Cum!" - A Private Tutor In Knee Socks Does Cum Control On Her Cherry Boy S*****t! - She Makes Him Save It Up Until He's Ready To Explode, Then Finally Lets Him Cum Inside Her!

  • manami oura miho tsuno censoredslutVRTMv r producegoro koenjiVRTM-488VRTM488h-910vrtm00488
    • 2020-01-23
    160 min

    [SW-680]The Girls In My Neighborhood Sit On The Stairs In Miniskirts With Their Panties Showing, And Their Panties Are Dripping Wet! - They're Just Waiting For Someone To Pull Their Panties Aside And Give Them A Good Fucking! - I Thrust My Cock D

  • censoredSWswitchyocchanSW-680SW6801sw00680
    • 2019-12-13
    119 min

    [VRTM-471]This Kind And Gentle Big Ass Big Stepsister Was Wearing A Tight Skirt And Exerted Her Total Domain Over A Horny Little Stepbrother! When She Was Given Aphrodisiacs, She Started To Rub Her Knee-High Socks Against Him And Dripped Juicy Stains

  • nanako miyamura ririka censoredcreampiesisterVRTMv r producegoro koenjiVRTM-471VRTM471h-910vrtm00471
    • 2019-11-14
    240 min

    [HUNTA-684]I Moved To Tokyo And Now I Live In An Apartment Located 5 Minutes From My Trade School! But Every Day, The Girls From Class Come Over To Spend The Night... I Was Enjoying My Life, Living On My Own...

  • censoredblowjobHUNTAhunterkawajirihhh groupHUNTA-684HUNTA684hunta00684
    • 2019-09-13
    107 min

    [VRTM-452]"Oh My... You Aren't Trying To Lure Me To Temptation, Are You...？" He Was Alone In The House With His Big Brother's Girlfriend, And All She Was Wearing Was A Single Button-Down Shirt, And No Bra Over Her Big Tits! He Could S

  • anne mashiro hamazaki mao censoredcreampiebig titsVRTMv r produceken hosokawaVRTM-452VRTM452h-910vrtm00452
    • 2019-09-13
    121 min

    [VRTM-453]This Little Brother-In-Law Is Lusting For His Kind And Gentle Big Ass Big Sister-In-Law Who Wears A Tight Skirt! When He Gave Her Aphrodisiacs To Drink She Started Rubbing Her Knee-High Socks Up Against Him And Staining Her Panties, And The

  • otsuki sound yuki sakuragi censoredcreampiesisterVRTMv r producerokutanzo no seishiVRTM-453VRTM453h-910vrtm00453
    • 2019-09-05
    166 min

    [SSNI-555]I Can See My Girlfriend's Sister's Panties! My Girlfriend Is Right Next To Us But Her Slutty Older Sister Brazenly Tries To Seduce Me! Moe Amatsuka

  • angel moe censoredslutsingle workSSNIs1 no 1 stylegoemonSSNI-555SSNI555ssni00555
    • 2019-07-25
    117 min

    [GS-273]My Cock Gets Commandeered By A Sexy Scary Lady! The Woman Who Lives Upstairs Is Beautiful, But She Never Says Hello To Me. I Can See Up Her Miniskirt When She Walks Up The Stairs, But Is She Showing Me Her Panties On Purpose...？

  • censoredcreampieGSsosoru x garconspada ikebukuroGS-273GS2731gs00273
    • 2019-03-16
    182 min

    [OYC-242]A Man Who Loves His Older Stepsister Too Much Secretly Films Her. He Has Always Adored His Stepsister. To Stop Himself From Doing Something He Shouldn't, He's been Secretly Filming Her Getting Changed, Taking A Bath, Her Pantyshots A

  • censoredcreampiesisterOYCoyashoku.companyhamonhhh groupOYC-242OYC242oyc00242
    • 2019-03-10
    300 min

    [EQ-444]I'll Pay You To Fuck My Friend's Girlfriend!

  • censoredbig titsamateurEQbullittimpulseEQ-444EQ444h-100eq00444
    • 2019-02-07
    111 min

    [GS-239]I Was Living A Lonely Single Life, When I Finally Met This Hot And Cute Girl Who I Often Noticed Living In The Same Apartment Building But I Didn't Have The Guts To Ask Her Out Because I Was Such A Coward But One Day, I Found Her Passed O

  • censoredGSsosoru x garconkinton kuriGS-239GS2391gs00239
    • 2019-01-24
    114 min

    [GS-237]I Live In The Male Dorm, And There's One Thing That I Can't Get Out Of My Mind... The Elder Sister Cleaning Lady Who Prances Around In A Tight Skirt Showing Off Her Big Ass!! She's Turning Me On And I Can't Resist Her, So I Se

  • censoredGSsosoru x garconkinton kuriGS-237GS2371gs00237
    • 2018-12-13
    235 min

    [GDHH-132]My Big Sister Is A Slut That Specializes In Stealing Men's Virginity! When I Bring My Cherry-Boy Friends Home, She Tempts Them By Flashing Her Panties And Tits! "Stop That!" I Kick Her Out Of My Room, But She Somehow Ends Up Alo

  • censoredGDHHgolden timerobby kunhhh groupGDHH-132GDHH132gdhh00132
    • 2018-03-08
    225 min

    [DANDY-592]"Go Ahead And Jack Off While Staring At My Panties" The Patient In The Hospital Bed Next To Mine Has A Girlfriend Who Keeps Coming Over And Teasing Me With Panty Shot Action Because She's A Horny Slut vol. 1

  • censoredbig titsblowjobDANDYdandygarret hashimotoDANDY-592DANDY5921dandy00592
    • 2018-02-02
    120 min

    [DOKS-420]Alluring Temptation Panty Shot Rhythm

  • sakura chinami madoka ibuki censoredschoolgirlblowjobDOKSoffice k sforever youngDOKS-420DOKS42036doks00420
    • 2017-09-03
    243 min

    [HUNTA-346]When She Passes Out Drunk, She's Incredibly Hot？! My Big Sister's Friend Doesn't Have a BF (Even Though She's Cute and Has Big Tits), So She Was Really Sad When She Went to a Festival in a Cute Yukata and Didn't Get Hit

  • censoredHUNTAhunterkawajiriHUNTA-346HUNTA346hunta00346
    • 2017-07-20
    119 min

    [SW-498]A Boy In The Throes Of Puberty Suddenly Sees a Miniskirt Panty Shot Play Out Right Before His Eyes! And When He Stops To Stare, These Mischievous Older Girls Sate Their Sexual Desires By Slowly Tasting His Hard Cock 2

  • censoredSWswitchdragon nishikawaswitch switchSW-498SW4981sw00498
    • 2017-07-08
    118 min

    [ARM-616]Temptation Panty Shot Collection 2

  • otsuki sound yuki sakuragi censoredslutARMaroma planningdont knowaromaARM-616ARM616arm00616
    • 2017-05-18
    120 min

    [SW-486]This Elder Sister Pretended To Walk Into This Adult Goods Shop By Mistake And Now We're Here Inside The Store Together! She Rubbed Her Ass Against My Crotch And Begged Me To Fuck Her So That The Other Customers And Staff Wouldn't Know

  • censoredslutSWswitchdragon nishikawaswitch switchSW-486SW4861sw00486
    • 2017-03-18
    181 min

    [SW-472]When Her Boyfriend Was Hospitalized, This Horny Girl Came To Visit Him Wearing A Tight Miniskirt And Flashing Panty Shot Action, While I Was In The Next Bed With A Rock Hard Erection Behind The Curtain, My Cock Grazed Against Her Ass, And Whe

  • censoredslutSWswitchSW-472SW4721sw00472
    • 2017-03-17
    231 min

    [HUNTA-280]My Aunties Live In City And They're Back Home For The First Time In A While, And Man They Are Sexy And Hot! 3 I Got Instantly Hard Looking At Their Cleavage And Panty Shot Action, And I Thought They Would Treat Me Like A Child, But Ins

  • censoredcreampieHUNTAhunterkawajirihhh groupHUNTA-280HUNTA280hunta00280
    • 2017-03-08
    130 min

    [PARM-116]Panty Shot Temptation From Above 4 This Elder Sister Was Searching For Something

  • yurina aizawa aoi mizutani censoredPARMaroma planningmoso chirarizumuPARM-116PARM116parm00116
    • 2017-03-02
    188 min

    [SW-469]My Big Sister Lives In A Shared House With A Male Prohibition Rule, But I Got Inside Because I'm Her Little Brother These Female Residents Have Been Starved For Manly Cock, So They Welcomed Me With Panty Shot Temptation! When I Decided To

  • censoredSWswitchSW-469SW4691sw00469
    • 2016-12-08
    119 min

    [SW-452]A Miniskirt Panty Shot Appears Suddenly Before The Adolescent Young Man! A Sex Loving Elder Sister Who Loves Pranks Is Enjoying The Taste Of This Erect Young Boy's Rock Hard Cock

  • censoredslutSWswitchdragon nishikawaswitch switchSW-452SW4521sw00452
    • 2016-12-08
    185 min

    [STAR-731]Iori Kogawa My Friend's Big Sister Has Such A Big Voluptuous Ass That An Ass Lover Like Me Is Always Having Hot And Sexy Daydream Fantasies About Her

  • iori furukawa censoredsquirtingsingle workSTARsod createakai suiseiSTAR-731STAR7311star00731
    • 2016-09-22
    119 min

    [SW-437]An Elder Sister Walks Into An Adult Video Shop By Mistake, And Now We're Alone Together In This Cramped Little Place, And My Cock Is Rock Hard And Ready I've Got 3 Pretty And Tight Asses Rubbing Up Against My Cock, And So I Decided To

  • censoredSWswitchdoragon nishikawaSW-437SW4371sw00437
    • 2016-02-18
    360 min

    [SW-388]I Was Fucked By Older Girls Who Tempt Me Every Morning As They Take Out The Trash By Exposing Their Big Asses And G Strings.

  • censoredSWswitchtocchiswitch switchSW-388SW3881sw00388
    • 2015-07-09
    130 min

    [SW-341]My Older Sister's Friends Are Coming To Sleep Over At Our House？ The Friends Show Off Their Panties To Me And I Just Can't Hold It Anymore! "I'll Fuck All Of You While You're Asleep!"

  • censoredsisterSWswitchyocchanswitch switchSW-341SW3411sw00341
    • 2014-12-20
    120 min

    [WANZ-277]Curvy Panty Shot Temptation Riko Honda

  • honda censoredbig titssingle workWANZwanz factorywanzWANZ-277WANZ277wanz00277
    • 2014-10-25
    118 min

    [WANZ-254]Voluptuous Temptation - Panty Shots Yu Asakura

  • yu asakura censoredsingle workWANZwanz factorywanzWANZ-254WANZ2543wanz00254
    • 2014-08-09
    120 min

    [MIDE-141]Elder Sister's Tempting Panty Shots! Yui Nishikawa

  • yui nishikawa censoredbeautiful girlslutMIDEmoodyzmoodyz divaMIDE-141MIDE141mide00141
    • 2014-07-24
    132 min

    [SW-271]Incest Dream! "You've Looked At Big Sis's Panties Too Much (Heart)" I Get Rock Hard Looking At My Grown-Up Big Sisters, But It Was She Who Came Onto Me

  • censoredSWswitchyocchanswitch switchSW-271SW2711sw00271
    • 2014-06-08
    120 min

    [MIDE-118]Older Sister's Panty Shot Temptation - Yuria Satomi

  • satomi yuria censoredslutsingle workMIDEmoodyzpornostarmoodyz divaMIDE-118MIDE118mide00118
    • 2014-05-29
    116 min

    [MIAD-685]Female Teacher With A Tight Skirt Riho Hasegawa

  • riho hasegawa censoredslutsingle workMIADmoodyztameike goromoodyz acidMIAD-685MIAD685miad00685
    • 2014-05-29
    120 min

    [WANZ-193]Silly Temptation: Panty Shots Yui Oba

  • oba yui censoredsingle workWANZwanz factorywanzWANZ-193WANZ1933wanz00193



    • Japan xxx, japanese adult videos, japani sexy, Japanese Adult Movies, JAV censored, Japanese tube, Japanese sex online