jav javcensored housewife high visio slut




FC2DASDAVSAJUFENACRDTTHUNTBCAWDMVSDMEYDWAAAAWDMILKVEMASDABMARAONEZROYDABWCHRVVENU

2021-01-09
120 min

[IPX-592]102 Orgasms! 98 Spasms! 8600 cc Of Squirting! Extreme Erotic Trance Ecstasy FUCK Rio Kuriyama

  • rio kuriyama censoredbig titssquirtingIPXidea pocketinaballdishIPX-592IPX592ipx00592
    • 2021-01-16
    74 min

    [MBF-005](A FANZA Exclusive) (For Streaming Editions) The Charlatan Couple - A Deceptive Woman And A Deceived Woman - Hibiki Otsuki Yui Hatano Chapter 2 A Perverted Couple Who Deceived My Neighbors And Fucked Them Both

  • otsuki sound yui hatano censoredcreampiebig titsMBFmax ak c takedaMBF-005MBF005mbf00005
    • 2021-01-23
    119 min

    [CAWD-175]Cavernous Cleavage! See-Through Shirts! Puffy Nipples! The Hot Girl Next Door Wants You To Cheat With Her - Busty Slut Seduces You - Your Girlfriend Has No Idea - Is There Any Way You Can Win Against Her Temptation... Kurumi Momota

  • hyakuta walnut censoredbig titsslutCAWDkawaiisuisei akaiCAWD-175CAWD175cawd00175
    • 2021-02-02
    63 min

    HEYZO 2451 Discrete Maid Is Ready For Naughty Care Vol.12 – Miyu Ono

  • miyu ono uncensoredcreampieheyzo
    • 2021-02-03
    111 min

    435MFC-077 [Gonzo to try] Gonzo with her best friend who is a slut with an H cup & 105 cm big ass! Erection does not stop in the overwhelming flesh body 2 consecutive SEX * Maria / 23 years old / beauty member

  • maria censoredcreampiebig titsmfcmfc-077mfc077435mfc-077
    • 2021-02-06
    122 min

    [JUL-470]Close-up Sex: Unfaithful Guidance, Drowning In Carnal Desire For My Son's Homeroom Teacher - Reiko Kobayakawa

  • kobayakawa reiko censoredbig titsmature womanJULmadonnarokusaburo mishimaJUL-470JUL470jul00470
    • 2021-02-06
    117 min

    240TOKYO-406 Asami

  • amateur censoredanalamateurtokyotokyo-406tokyo406240tokyo-406
    • 2021-02-06
    44 min

    C0930 ki210207 Hitomi Aoshima 25years old

  • amateur uncensoredc0930
    • 2021-02-11
    135 min

    [SW-756]I Like Older Men. My Friend's Little Sister Was Totally My Type, And She Was The Kind Of Sch**lgirl Who Loved To Lure Men To Temptation! She Got Me Hot And Hard With Her Total Domain Of Knee-High Socks, And Tempted Me With Her Sweet Voice

  • kagami sara censoredschoolgirlsingle workSWswitchSW-756SW7561sw00756
    • 2021-02-16
    137 min

    [SDDE-644]Room Boundaries x NTR - This Entire Family Is Mine To Do As I Please, Heh Heh Heh! -

  • yui hatano yurika censoredcreampiebig titsSDDEsod createryo inugamisenzSDDE-644SDDE6441sdde00644
    • 2021-02-19
    152 min

    [MMYM-043]Obscene Woman June Lovejoy

  • june lovejoy censoredslutsingle workMMYMmarrionaida yumenoyumenoMMYM-043MMYM043mmym00043
    • 2021-02-20
    59 min

    FC2PPV 1693887 [Rookie National Treasure] First shot beautiful ace Ayu-chan advent! Natural E cup beauty big breasts model tall 167 cm solid vaginal cum shot. I can only praise you anymore * Complete appearance

  • amateur uncensoredfc2
    • 2021-02-24
    179 min

    FC2PPV 1699100 049 [Facial cumshot from cum] That super popular sexy actress made a crispy beauty drink a lot of sperm and made her face dirty

  • amateur uncensoredfc2
    • 2021-03-06
    239 min

    [HUNTA-960]"Please Stop! I'm Cumming So Much I Think I'm Going To Lose My Mind!" My Little Stepsister Was Thrusting Out Her Tight, Godly Ass, And I Could No Longer Resist ... So I Entered Her Raw, From Behind! And Then I Pumped Her Wi

  • censoredcreampieschoolgirlHUNTAhuntervolvo nakanohhh groupHUNTA-960HUNTA960hunta00960
    • 2021-03-17
    130 min

    [GVH-205]Naughty Nurses - Rei Kuruki

  • satoshi kuruki censoredcreampiegrandfatherGVHglory questmishima rokusaburoGVH-205GVH20513gvh00205
    • 2021-03-21
    153 min

    [CAWD-199]This Virgin's Never Even Fucked Her Boyfriend Of Five Years! Sweet Country Girl From Tokushima, Age 20, With An Adorable Accent Makes Her Porn Debut Before She Ties The Knot! Ayami Emoto

  • ayami emoto censoredbeautiful girlsingle workCAWDkawaiirakudaCAWD-199CAWD199cawd00199
    • 2021-03-25
    165 min

    [SPRD-1389]My Fuck Buddy Is My Friend's Mom Ayaka Makimura

  • ayaka makimura censoredbig titsmature womanSPRDtakara eizokon oriharualeddinSPRD-1389SPRD138918sprd01389
    • 2021-04-15
    180 min

    [DIPO-091]Hung Older Guy Secretly Films His Fucks With A Married Slut - Lost In Creampie Sex

  • censoredDIPOprimoero nandesuDIPO-091DIPO091h-283dipo00091
    • 2021-05-07
    119 min

    [MEYD-675]I Went To A Rubber Mat Health Club That Didn't Allow Fucking, And Out Came The Haughty And Naughty Beautiful Married Woman From Next Door. Now That I Knew Her Secret, I Could Get All The Sex And Creampie Fucking I Wanted! And Even Outsi

  • hikari hime censoredcreampiesingle workMEYDtameike goroshiro shotenMEYD-675MEYD675meyd00675
    • 2021-05-08
    181 min

    [SQIS-049]Wild Girls - Contemporary Sex Scenery Vol. 6

  • censoredmature womandramaSQISfa proSQIS-049SQIS049sqis00049
    • 2021-05-08
    180 min

    [DGCEMD-006]Delivery Only! Special Video Included Pleasure! First Experience! Wan Horikita Documentary Of Girl Having Sex And Peeing Herself In Front Of Others For The First Time

  • horikita wa censoredsquirtingmature womanDGCEMDcelebrity friendsDGCEMD-006DGCEMD006dgcemd00006
    • 2021-05-29
    121 min

    [JJCC-001]A Married Woman's Overflowing Honey

  • censoredcreampiemature womanJJCCjukujo japanJJCC-001JJCC001jjcc00001
    • 2021-06-01
    63 min

    10musume 060121_01 Let me cum inside Saeko Misawa

  • amateur uncensored10musume
    • 2021-06-05
    106 min

    [VENX-042]I Mistook My Resting Mother-In-Law's Ass For My Wife's, And Stuck My Dick Right In Without Knowing It Was Actually My Mother-In-Law. Yuna Kitano

  • yuna kitano censoredcreampiemature womanVENXvenusmajime kitanofakecest winntersVENX-042VENX042venx00042
    • 2021-06-06
    51 min

    188HINT-0458 Akie

  • amateur censoredbig titssquirtinghinthint-0458hint0458188hint-0458
    • 2021-06-20
    120 min

    [SRMC-033]Hypno-drama: A Wife With A Big Ass Drowning In Influenced Pleasure - Yurika Aoi

  • yurika censoredsquirtingsingle workSRMCh m rashmiyoshi rusherSRMC-033SRMC033srmc00033
    • 2021-06-22
    135 min

    [KIRE-040]Extremely pretty! Starring both Akane Soma and Mariko Sata A blowjob-crazy housewife orders food, seduces the young delivery guy, and pulls away during successive ejaculations! 8 cum shots in total

  • mariko sada soma censoredcreampiemature womanKIREsod createsakai shiberiarei kirei sodKIRE-040KIRE0401kire00040
    • 2021-06-26
    132 min

    [SQTE-373]Who Did This!？ Beautiful Girl Narumi, Plowed To The Depths Of Her Throad - Narumi Hirose

  • narumi hirose censoredcreampiebeautiful girlSQTEs cuteSQTE-373SQTE373sqte00373
    • 2021-07-05
    65 min

    493NAEN-072 Cow! ？？ Babumi MAX! ？？ First Gonzo! Hell to squid chubby JD Nao Kikuchi

  • amateur censoredamateurnaennaen-072naen072493naen-072
    • 2021-07-12
    69 min

    NIQN-005 Kanon

  • amateur censoredbig titsamateurniqnniqn-005niqn005niqn-005
    • 2021-07-18
    65 min

    FC2PPV 1927955 [Celebration ♥ Creampie] [Pre-Sale] The Third Work Of Mayu-Chan, A Tall Slender Beauty. She Takes Advantage Of Her Feelings Of Comfort During Insertion And Negotiates Vaginal Cum Shot. She Removes The Rubber And Inserts It On Condition

  • amateur uncensoredfc2
    • 2021-07-20
    61 min

    1Pondo 072021_001 Experience Anal SEX for the first time! Kurumi Tokito

  • amateur uncensored1pondo
    • 2021-07-23
    127 min

    [VAGU-238]The Female Boss Became A Mannequin To Handle Complaints - Beautiful Mannequin Madame Series - Yuka Mizuno

  • yuka mizuno censoredcreampiemature womanVAGUvenuskanieultimaVAGU-238VAGU238vagu00238
    • 2021-07-27
    135 min

    [STARS-422]The Stepcousin That Came Back For Summer Vacation Seduces Her Stepcousins And Jerks Them All Off! 10 Shots In Total! Himari Asada

  • asada himari censoredbig titssoloworkSTARSsod createyosukesod starSTARS-422STARS422
    • 2021-08-03
    136 min

    [SDMM-094]Magic Mirror Bus, College Girls Going To Tokyo Only! Intense Vibrating Climax Chair Switch ON While On Video Call With Boyfriend! She Wins A Prize If She Finishes The Call Without Being Found Out! But... Her Clit Is So Stimulated That Her N

  • amaha noi censoredsquirtingamateurSDMMsod createdainanamirror noSDMM-094SDMM094
    • 2021-08-09
    63 min

    SIRO-4601 [First Shot] [First Experience G Milk Fucking] [Indecent Eyes] A Nutritionist Who Has Both Cuteness And A Lewd Atmosphere. If You Get A Concentrated Attack On The Fruitful Breasts And Stir The Thickened Secret Part .. AV Application On The

  • amateur censoredbig titssquirtingsirosiro-4601siro4601siro-4601
    • 2021-08-11
    59 min

    500DPL-0025 AV Debut Of Creampie Girls In Science Girls While Enrolled In Six Universities!

  • amateur censoredcreampieamateurdpldpl-0025dpl0025500dpl-0025
    • 2021-08-13
    74 min

    529STCV-003 Yuhi

  • amateur censoredcreampieschoolgirlstcvstcv-003stcv003529stcv-003
    • 2021-08-18
    136 min

    [GVH-278]I Visited My Cousin For The First TIme In Years, And She Had Grown Some Colossal Tits, Riho Takahashi

  • riho takahashi censoredbig titssingle workGVHglory questhyonGVH-278GVH27813gvh00278
    • 2021-09-03
    123 min

    [WAAA-095]My Colleague Seduced Me With Her Ass And Made Me Fuck Her Over And Over Yu Shinoda Aoi Kururugi

  • shinoda yu aoi kururugi censoredcreampieslutWAAAwanz factoryWAAA-095WAAA095waaa00095
    • 2021-09-04
    159 min

    [YMDD-242]The Little Stepsister Catering Service - She Gets To Monopolize Her Big Stepbrother"s Love! An Innocent And Pure, Angelic Little Stepsister Is Playing Erotic Pranks On Me -

  • yuzu shirakawa kanon kanon censoredcreampieblowjobYMDDmomotarou eizou shuppanasakusa ga jirojaku momoYMDD-242YMDD242ymdd00242
    • 2021-09-07
    131 min

    [090721_001]セクシー女優スペシャル版 ～ 鈴木さとみ 舞咲みくに～

  • amateur uncensored1pondo
    • 2021-10-03
    62 min

    SIRO-4612 [First Shot] [Tall Slender] [Unusual Beauty] If You Pass Each Other In The City, You Will Find An S-Class Beauty Dental Assistant Who Will Be Confirmed Twice. She Says That She Is Easy To Feel The Whole Body, Once The Play Starts, She Makes

  • amateur censoredamateursirosiro-4612siro4612siro-4612
    • 2021-10-05
    61 min

    Caribbeancom 100521-001 The Continent Full Of Hot Girls, File.084 Kurumi Kokoro

  • kurumi kokoro uncensoredcreampiecaribbeancom
    • 2021-10-15
    117 min

    [MUDR-167]Innocent New Face Debut For Newcomer. A Quiet Barely Legal That Feels Insecure... Nene Hiiragi

  • hiiragi censoredcreampieschoolgirlMUDRmukuMUDR-167MUDR167mudr00167
    • 2021-10-20
    37 min

    FC2PPV 2359625 First Shot! !! Limited Number! [Uncensored] Innocent And Obedient Beautiful Girl Is Brought Into A Closed Room And Vaginal Cum Shot! !! I Usually Pretend To Be Serious … (Bonus First Appearance Blowjob Mouth Ejaculation)

  • amateur uncensoredfc2
    • 2021-11-12
    120 min

    [MIDV-004]The Senior Hope Of My Dreams Has Been Gangfucked By A Strong Swimmer... Hope Ishihara

  • ayano murasaki rui mizutani censoredbig titsmature womanMIDVmoodyzkitorune kawaguchimoodyz divaMIDV-004MIDV00448midv00004
    • 2021-12-02
    114 min

    [AARM-038]Best Blowjob Where She Keeps Helmet In Mouth While Ferociously Slurping Rod Like a Tornado.

  • ikuta miku tsukishima sakura censoredblowjobhandjobAARMaroma kikakukadowaki shigeoaromaAARM-038AARM038aarm00038
    • 2021-12-03
    114 min

    [ADN-358]Ravaged In Front of Husband - Reunion Is The Start Of Doom!!! Reira Kuon

  • leira haduki censoredsingle workdramaADNattackerskazumaotona no dramaADN-358ADN358adn00358
    • 2021-12-09
    135 min

    [STARS-478]ドバドバ精子垂れ流し悶絶昇天メンズエステ4シチュ3sex ローレン花恋

  • lauren hanako censoredsoloworkSTARSsod createzack araisod starSTARS-478STARS478
    • 2021-12-23
    725 min

    [FCDSS-021]Sora Amakawa FALENO Complete BEST 12 Hours With All 15 Titles

  • tenkawa sora censoredbig titsbeautiful girlFCDSSfalenofaleno starFCDSS-021FCDSS0211fcdss00021
    • 2022-01-01
    128 min

    [GVH-341]A Big Tits Mother And Daughter Get The Double NTR Treatment When Their Big Dick Step Uncle Returns From Overseas To Indulge In A Mother/Daughter Sex Sandwich During A Nightmarish 3 Days Of Fucking Hana Haruna Rin Asahi

  • haruna hana rin asahi censoredbig titssisterGVHglory questusubashisuiGVH-341GVH341gvh00341
    • 2022-01-03
    72 min

    530DG-050 God Times! ？？ Popular Distributor ＃ 02 Violated During Live Streaming

  • amateur censoredcreampiebig titsdgdg-050dg050530dg-050
    • 2022-01-06
    62 min

    520SSK-045 Riria

  • amateur censoredamateurbeautiful girlsskssk-045ssk045520ssk-045
    • 2022-01-08
    139 min

    [URKK-051]The Perverted Landlord Next Door Rubs My Tits And Fucks Me Every Day. Hana Himesaki

  • himesaki hana censoredcreampiebig titsURKKunfinishedrolanda familiar breastURKK-051URKK051urkk00051
    • 2022-01-15
    240 min

    [TIKB-130][Inducted Into The Hall Of Fame Of Tipsy Sucking] Tipsy Women Are The Best - Theory! vol. 1

  • hamazaki mao himari kinoshita himari hanazawa censoredcreampieTIKBchikichikiba gu mousozokuTIKB-130TIKB130tikb00130



    • Japan xxx, japanese adult videos, japani sexy, Japanese Adult Movies, JAV censored, Japanese tube, Japanese sex online