jav javcensored censored high vision knee socks




FC2HNDSDABHUNTBWAAAGMEMSSNIMILKSQTEDTTCHRVWANZJUFEPPPDDASDJULKSBJPREDRBDONEZSHKD

2021-12-24
184 min

[HUNTB-171]Glasses x Knee-High Socks x Miniskirt x Thong This Sch**lgirl Is So Excessively Erotic, She"s Giving Me A Full-On Hard On! "I Don"t Know If I Can Make You Feel Good, But I Can Do Some Sexy Things For You ..."

  • censoredschoolgirlHUNTBhuntermorikihhh groupHUNTB-171HUNTB171huntb00171
    • 2021-11-25
    200 min

    [SW-813]C***dhood Friend With A Knee-high Stocking S********l Outfit Gives A Panty Shot, And I Got To See Her Thighs And Panties! She Has Liked Me For A Long Time It Seems, And Hearing Her Cutely Confess Her Feelings Got My Dick So Hard!

  • censoredschoolgirlSWswitchraito fuji makotoswitch hibinoSW-813SW8131sw00813
    • 2021-06-19
    146 min

    [CAWD-242]Tempting Knee High x Total Domain: HinanoTachibana

  • hinano tachibana censoredsingle workCAWDkawaiitake dCAWD-242CAWD242cawd00242
    • 2021-04-20
    88 min

    [KIR-032]Little Stepsister For Rent "She Can Visit Your Home, No Touching" Haru Yamaguchi

  • yoko yamaguchi censoredcreampieblowjobKIRstar paradisekirei star paradiseKIR-032KIR032h-254kir00032
    • 2021-02-13
    134 min

    [DVAJ-499]I Can Tell That My C***dhood Friend Loves Me But She's A Naughty Bitch Whether She's Fucking Or Not Who Won't Ever Admit That She's Cumming But Now We're Living Together In A Tsundere Sex Life Together Aoi Kururgi

  • aoi kururugi censoredcreampiebeautiful girlDVAJalice japanjo asagiriDVAJ-499DVAJ499dvaj00499
    • 2021-01-15
    205 min

    [BAZX-266]The Total Domain Of A Beautiful Y********l In Uniform Who Wants To Be Watched What A Slut vol. 002

  • censoredcreampieuniformBAZXbazookatodoBAZX-266BAZX266h-1496bazx00266
    • 2020-12-18
    120 min

    [ONIN-055]Knee-High Socks & Miniskirt - The Ultimate Gap - Masturbation With Panties Still On

  • censoredamateurONINtamanegi mousouzokudoryu barrymoretamanegiONIN-055ONIN055onin00055
    • 2020-11-13
    116 min

    [VRTM-520]"I'm Not Gonna Let You Cum!" - A Private Tutor In Knee Socks Does Cum Control On Her Cherry Boy S*****t! - She Makes Him Save It Up Until He's Ready To Explode, Then Finally Lets Him Cum Inside Her! 2

  • aishin shinkawa kurata mao censoredslutVRTMv r producegoro koenjiVRTM-520VRTM520h-910vrtm00520
    • 2020-10-24
    146 min

    [DASD-752]The Domain Of Her Holy Golden Waters This Beautiful Secretary Received Breaking In Pissing Training From Her Critical President And Now She's Dripping Piss Down Her Marshmallow-Soft Skin And Thighs. Rika Tsubaki

  • tsubaki rika censoredbeautiful girlsingle workDASDdasgoemonDASD-752DASD752dasd00752
    • 2020-10-22
    168 min

    [NHDTB-452]Crotch Grabbing In A Stressful Standing Position - Stuck Standing Even If Her Legs Fall Out From Under Here, A Girl With Beautiful Legs Cums Over And Over Again -

  • censoredsquirtingschoolgirlNHDTBnatural highkansukeNHDTB-452NHDTB4521nhdtb00452
    • 2020-10-03
    181 min

    [HUNTA-858]My Place Is A Hangout For All Of The Girls In Class, And Now It's A Piece Of Heaven, Filled With Knee-High Socks And Thongs!! Since My Parents Are Away At Work, When School Lets Out, All Of My Bored Classmate Girls Cum On Over...

  • censoredcreampieschoolgirlHUNTAhuntercognac kaminohhh groupHUNTA-858HUNTA858hunta00858
    • 2020-10-02
    72 min

    [IMPNO-026]I'm Not Nude, I'm Wearing Knee-High Socks #03 Aya Kitano

  • aya kitano censoredanalsingle workIMPNOimpactnon label impactIMPNO-026IMPNO026h-1154impno00026
    • 2020-09-10
    131 min

    [HBAD-554]Kneehigh Sleepy Fuck, NEET Brother's Warped Desire Chiharu Sakurai

  • chiharu sakurai censoredsingle workHBADhibinorokutanzo no seishibabeHBAD-554HBAD5541hbad00554
    • 2020-08-29
    162 min

    [MIAA-310]A Total Domain With No Panties To Turn You On! A Little Devil Barely Legal Babe In Knee-High Socks Will Knock Your Erection Out With Pussy-Peeping Temptation Urara Kanon

  • hanaoto urara censoredschoolgirlslutMIAAmoodyzgoemoneveryone s porn starMIAA-310MIAA310miaa00310
    • 2020-07-23
    240 min

    [SW-715]I Saw This S********l In Knee-High Socks Every Morning, Flashing Panty Shot Action At Me, And She Was So Cute That She Made My Dick Hard, And She Said, "You're Such A Pervert" And Puffed Up Her Cheeks In Anger. But Then Her Eyes W

  • sena ai sakaegawa noa censoredSWswitchswitch switchSW-715SW7151sw00715
    • 2020-06-12
    113 min

    [VRTM-504]"I Came And Cleaned Up That Old Man's House And Made It Nice And Tidy..." This Y********l Was Full Of Innocence And Purity And Wanted To Make Some Money So She Cleaned House While Wearing A School Swimsuit And Knee-High Socks An

  • kanon kanon kiyoshi saki censoredcreampieVRTMe bodygoro koenjiv r produceVRTM-504VRTM504h-910vrtm00504
    • 2020-06-06
    174 min

    [AP-773]Uniforms And Knee-High Socks In Hot Pursuit Of Sexy S********ls

  • censoredcreampieschoolgirlAPapachegeronimohhh groupAP-773AP773ap00773
    • 2020-05-15
    229 min

    [BAZX-232]The Total Domain Of A Beautiful Y********l In Uniform Who Wants To Be Watched What A Slut vol. 001

  • censoredcreampieuniformBAZXbazookatodoBAZX-232BAZX232h-1496bazx00232
    • 2020-05-08
    130 min

    [IENF-080]My Big Tits Little Stepsister Is Tempting Me By Wearing A Knitted One Piece Dress And Knee-High Socks, And Thrusting Her Ass At Me, And When I Could No Longer Resist, I Shoved My Cock Into Her Pussy, And Creampie Fucked Her, Over And Over A

  • yuri fukada aya mitsuki censoredcreampiebig titsIENFienergyieneIENF-080IENF0801ienf00080
    • 2020-04-25
    118 min

    [MIAA-262]Total Domain Love: Beautiful Y********l in Uniform With Knee-high Skirt: Ichika Matsumoto

  • ichika matsumoto censoreduniformbeautiful girlMIAAmoodyzrakudaeveryone s porn starMIAA-262MIAA262miaa00262
    • 2020-04-25
    150 min

    [MIFD-112]Working For The Knee High Socks Project Planning And Development Department Of A Famous Apparel Company! This Newly Graduated, Tall Girl Landed A Provisional Offer By Showing Off Her Total Domain, And Now Makes Her AV Debut Haruka

  • haruka censoredbeautiful girlsingle workMIFDmoodyzmon cmoodyz freshMIFD-112MIFD112mifd00112
    • 2020-04-23
    120 min

    [SW-699]Not Only Does She Have Big Tits, She Never Wears A Bra, So Her Titties Are Jiggling And Wiggling And I Can See Them And I Can't Take My Mind Off Of It, And She's Wearing Knee-High Socks And That Total Domain Of Eroticism Is So Allurin

  • censoredbig titsSWswitchswitch switchSW-699SW6991sw00699
    • 2020-03-19
    124 min

    [EKDV-620]Cosplay x Aoi Kururugi Deluxe Aoi Kururugi

  • aoi kururugi censoredcosplaybeautiful girlEKDVcrystal pictureshimakaze kune kissEKDV-620EKDV62049ekdv00620
    • 2020-03-16
    49 min

    [SHN-039]A High S*********l In Knee Socks Spreads Her Legs Wide And Enjoys The Feeling Of A Vibrator In Her Pussy

  • censoredsquirtingschoolgirlSHNnatural highkansukenach carefully selected daughterSHN-039SHN0391shn00039
    • 2020-03-13
    120 min

    [VRTM-488]"I'm Not Gonna Let You Cum!" - A Private Tutor In Knee Socks Does Cum Control On Her Cherry Boy S*****t! - She Makes Him Save It Up Until He's Ready To Explode, Then Finally Lets Him Cum Inside Her!

  • manami oura miho tsuno censoredslutVRTMv r producegoro koenjiVRTM-488VRTM488h-910vrtm00488
    • 2020-02-28
    239 min

    [OKAX-596]Fucking Forbidden! Testing The Options At A Secret Sexual Massage In The City! CCD Peeping 240 Min

  • censoreduniformschoolgirlOKAXk m producedick mandokuokazuOKAX-596OKAX59684okax00596
    • 2020-02-28
    62 min

    [IMPNO-019]I'm Not Naked, I'm Wearing Knee-High Socks - Ayaka Takahashi

  • takahashi ayaka censoredsingle workIMPNOimpactno directorIMPNO-019IMPNO019h-1154impno00019
    • 2020-01-17
    122 min

    [VRTM-476]"I Came And Cleaned Up That Old Man's House And Made It Nice And Tidy..." This Y********l Was Full Of Innocence And Purity And Wanted To Make Some Money So She Cleaned House While Wearing A School Swimsuit And Knee-High Socks An

  • scooping atomi shuri censoredcreampieVRTMv r producerokutanzo no seishiVRTM-476VRTM476h-910vrtm00476
    • 2020-01-12
    300 min

    [DVAJ-437]Looking Good In Knee-High Socks - Sex With 20 Beautiful Y********ls - 5 Hours

  • tsukasa aoi minami kojima censoredbeautiful girlDVAJalice japansagi kandaDVAJ-437DVAJ437dvaj00437
    • 2019-12-14
    196 min

    [OYC-295]Innocent High S*********ls In Knee-High Socks Get Broken In By Their Teachers

  • censoredschoolgirlOYCoyashoku.companyartesiahhh groupOYC-295OYC295oyc00295
    • 2019-12-13
    119 min

    [VRTM-471]This Kind And Gentle Big Ass Big Stepsister Was Wearing A Tight Skirt And Exerted Her Total Domain Over A Horny Little Stepbrother! When She Was Given Aphrodisiacs, She Started To Rub Her Knee-High Socks Against Him And Dripped Juicy Stains

  • nanako miyamura ririka censoredcreampiesisterVRTMv r producegoro koenjiVRTM-471VRTM471h-910vrtm00471
    • 2019-12-12
    181 min

    [SW-672]Every Morning I Would See This Panty Shot Sch**lgirl In Knee-High Socks And She Was So Cute That She Made My Cock Rock Hard, And She Would Puff Up Her Cheeks And Say To Me, "You're Such A Pervert" And Get Mad At Me. But Then She W

  • yui nagase censoredschoolgirlsingle workSWswitchlight fujimaSW-672SW6721sw00672
    • 2019-12-07
    159 min

    [IPX-417]I Made My Arrogant Little Stepsister Wear Knee-High Socks, And Become My Own Little Sex Slut, Under My Total Domain, And Thus, I Gave Birth To My Very Own Slut To Use As I Pleased. All Episodes Featuring Knee-High Socks! Yume Nishimiya

  • yume nishinomiya censoredslutsisterIPXidea pockettake ddishIPX-417IPX417ipx00417
    • 2019-11-17
    143 min

    [DASD-607]The Golden Shower Domain This Sch**girl Hates Her Teacher, But Now She's Receiving Pissing Breaking In Training, And Leaking Her Piss All Over Her Tanned Thighs Akari Neo

  • akari neo censoredcreampieschoolgirlDASDdasgoemonDASD-607DASD607dasd00607
    • 2019-11-08
    141 min

    [BLKW-001]#Peace #TiredOfSchool

  • censoredschoolgirlBLKWbalikawaBLKW-001BLKW001h-1437blkw00001
    • 2019-10-10
    186 min

    [SW-660]Every Morning, I See This Sch**lgirl Flashing Panty Shot Action At Me In Her Knee-High Socks And She Was So Cute That She Was Getting My Dick Hard And Then She Said, "You're Such A Pervert." And Then She Got Mad At Me. But Then He

  • kotone rui censoredschoolgirlsingle workSWswitchlight fujimaswitch switchSW-660SW6601sw00660
    • 2019-10-03
    320 min

    [HUNTA-662]I'm Super Popular With Girls In Knee-High Socks x Miniskirt Outfits, And I'm Fucking The Shit Out Of Them Too!! I Enrolled Into A New School, Which Was An All Girls School Until Last Year, And Just Turned Coed This Year!! During Ju

  • censoredschoolgirlHUNTAhuntervolvo nakanohhh groupHUNTA-662HUNTA662hunta00662
    • 2019-09-21
    177 min

    [NNPJ-363]Picking Up Amateur College Girls On The Street! Knee-High Edition - Proof That Short Skirts And Long Socks Mean She Wants To Get Fucked

  • censoredcreampiebeautiful girlNNPJnanpa japanNNPJ-363NNPJ363nnpj00363
    • 2019-09-13
    121 min

    [VRTM-453]This Little Brother-In-Law Is Lusting For His Kind And Gentle Big Ass Big Sister-In-Law Who Wears A Tight Skirt! When He Gave Her Aphrodisiacs To Drink She Started Rubbing Her Knee-High Socks Up Against Him And Staining Her Panties, And The

  • otsuki sound yuki sakuragi censoredcreampiesisterVRTMv r producerokutanzo no seishiVRTM-453VRTM453h-910vrtm00453
    • 2019-09-08
    151 min

    [IPX-368]A Budding Total Domain Alluring Temptation A Little Devil Beautiful Young Girl In Uniform And Knee-High Socks Kana Momonogi

  • kana momonogi censoredschoolgirlbeautiful girlIPXidea pocketkirindishIPX-368IPX368ipx00368
    • 2019-09-05
    157 min

    [SSNI-560]Total Domain Tall Girl Flashes Her Sexy Legs - A Nympho In Knee Highs Hotaru Nogi

  • nogi firefly censoredschoolgirlsingle workSSNIs1 no 1 stylegoemonSSNI-560SSNI560ssni00560
    • 2019-08-31
    237 min

    [CLUB-577]The Total Domain Of Girls In Uniform And Knee-High Socks They Giving Me A Dirty Talk Footjob And Forced Me To Cum Over And Over Again.

  • censoredCLUBhentai shinshi clubCLUB-577CLUB577club00577
    • 2019-07-13
    156 min

    [SSNI-520]Total Domain. She'll Constantly Tempt You With Her Beautiful, Slim Thighs. The Bewitching Beauty In Knee-High Socks. Arina Hashimoto

  • there is hashimoto censoredschoolgirlsingle workSSNIs1 no 1 stylemichiru arashiyamaSSNI-520SSNI520ssni00520
    • 2019-07-11
    220 min

    [SW-642]Every Morning, I Would See This Young Sch**lgirl In Knee-High Socks Showing Off Her Thighs And Flashing Panty Shot Action At Me, And She Was So Cute That She Was Giving Me A Hard On, And Then She Would Blush And Get Mad And Say, "You'

  • scooping censoredsingle workSWswitchlight fujimaswitch switchSW-642SW6421sw00642
    • 2019-07-07
    164 min

    [IPX-332]"I Love Middle-Aged Men..." She Wants To Be Fucked Passionately Over And Over Again! The Captivating Seduction Of A Beautiful Young Girl In Uniform With Knee-High Socks

  • mukai ohara censoredschoolgirlsingle workIPXidea pocketkahori maedanodishIPX-332IPX332ipx00332
    • 2019-06-07
    202 min

    [DOCP-151]It Was Only 3 Seconds, But Pussy Convulsions!？ Creampieing My Stepsister All Over The House!

  • arimura nozomi mai kashiwagi censoredcreampiesisterDOCPprestigedoc premiumDOCP-151DOCP151118docp00151
    • 2019-06-06
    225 min

    [SW-635]The Knee-High Socks And Thighs I See Every Morning. The Panty-Shot Schoolgirl Was So Cute, She Was Giving Me A Boner. "You Dirty Man." She Puffed Her Cheeks And Looked At Me Angrily. But She Quickly Started To Stare At Me With Teary E

  • arimura nozomi censoredsingle workSWswitchlight fujimaswitch switchSW-635SW6351sw00635
    • 2019-05-02
    119 min

    [EKDV-578]My Personal Slave Maid Azusa Misaki

  • misaki azusa censoredcreampiebeautiful girlEKDVcrystal eizokumataro morinoe kissEKDV-578EKDV57849ekdv00578
    • 2019-04-05
    176 min

    [DOCP-140]I Couldn't Control The Thrill I Felt From The Total Domain Peeking Out From Underneath Her Miniskirt... 2

  • ayu saito mai tominaga censoredDOCPprestigedoc premiumDOCP-140DOCP140118docp00140
    • 2019-04-04
    172 min

    [GDHH-145]This Prim And Proper Sch**lgirl Who Wears Glasses And Knee-High Socks Is, To Our Surprise, Wearing A Thong! Knee-High Socks x Thong Panties Is Getting Us Excited To The Max! She's So Sexy, Of Course We're Getting A Full Erection!! I

  • censoredcreampieschoolgirlGDHHgolden timekorosukehhh groupGDHH-145GDHH145gdhh00145
    • 2019-03-29
    243 min

    [SIM-031]I Got Super Excited For A Sch**lgirl In Knee-High Socks And The Total Domain Of Her Hot Thighs...

  • censoredcreampieschoolgirlSIMprestigeamateur pussiesSIM-031SIM031118sim00031
    • 2019-03-21
    218 min

    [SW-620]The Schoolgirl I See Every Morning In Knee-High Socks Flashing Her Thighs And Panties Is So Cute, She Makes My Dick Hard. She Gets Angry And Says "You Perv" With Puffed Up Cheeks. But She Quickly Starts To Look At Me With Teary Eyes.

  • mai yahiro censoredschoolgirlsingle workSWswitchlight fujimaswitch switchSW-620SW6201sw00620
    • 2019-03-06
    118 min

    [PRED-137]Wearing Knee High Socks, My Slutty Old Sister Makes Me Cum Over And Over! Mika Kurosaki

  • kurosaki mika censoredcreampieslutPREDpremiumkitorune kawaguchielegancePRED-137PRED137pred00137
    • 2019-02-23
    198 min

    [CJOD-178]Harem Of Nymphos With Hot Thighs 2. Caught Between Their Beautiful Legs And Unable To Move, They Make Me Cum Inside Them Over And Over Again!!

  • hasumi claire rino kirishima censoredcreampieslutCJODchijo heavennao masakiCJOD-178CJOD178cjod00178
    • 2019-02-23
    148 min

    [NNPJ-322]We Were There To Pick Up Girls But Got Picked Up Instead!？ A Young Office Lady In Knee-High Socks Tempts Cherry Boys With Her Thighs And Steals Their Virginity- The Complete Record. Pick-Up JAPAN EXPRESS vol. 93

  • censoredamateurNNPJnanpa japanNNPJ-322NNPJ322nnpj00322
    • 2019-02-21
    186 min

    [SW-614]I See Her Knee-High Socks And Thighs Every Morning. The Panty Shots Of A Cute College Girl Was Giving Me A Boner And She Got Mad At Me, Saying "You're A Dirty Man". But She's Really A Bewitching Tsundere Girl And She Started G

  • reiko mizuki censoredschoolgirlsingle workSWswitchlight fujimaswitch switchSW-614SW6141sw00614



    • Japan xxx, japanese adult videos, japani sexy, Japanese Adult Movies, JAV censored, Japanese tube, Japanese sex online