jav censored big tits high vision amateur




FC2ONEZMIDVAVSABBANWANZSSNICJODDTTAWDPREDMEYDGMEMDASDMARASPRDMILKMIAAGVHHMNCHRV

2020-11-30
75 min

484SD-002 If you talk to a gal who was dancing while drinking in front of the station, the super famous Tik T ○ ker will be listed in the ranking! ？？ Let’s take a picture with a camera! He was a super erotic dancer who would blow up to the tide

  • amateur censoredsquirtingamateursdsd-002sd002484sd-002
    • 2020-12-05
    171 min

    [URE-061]The Ultimate Hyponotic Seduction! Creator: Riku Aijo From The "Hypnotic Instructions" Series Comes Hypnotic Instructions 4: Instructions For Getting Girls Pregnant Maki Hojo And Ruka Inaba

  • hojo asahi inaba censoredschoolgirlmature womanUREmadonnakitorune kawaguchiure.comiURE-061URE061ure00061
    • 2021-01-01
    74 min

    FC2PPV 1623423 [No x hair wash] “Fully open” Taking a break while looking at your smartphone! [Part 2]

  • amateur uncensoredfc2
    • 2021-01-01
    144 min

    [SORA-289](Selfie Posting x Outdoor) Smoking Hot G-Cup MILF - She Got Swindled Into Cheating With A Coworker And We Caught The Whole Thing On Camera... Kasumi Ikeya (43 Years Old)

  • censoredamateurmature womanSORAyama to sorayosukeSORA-289SORA289sora00289
    • 2021-01-08
    115 min

    [PARATHD-3083]Penis Ranking List, As Chosen By Porn Actresses Who Sincerely Love Dick From The Bottom Of Their Hearts: Complete Edition

  • miori hara sana mizuhara censoredlesbianPARATHDparadise tvPARATHD-3083PARATHD3083parathd03083
    • 2021-01-15
    205 min

    [BAZX-266]The Total Domain Of A Beautiful Y********l In Uniform Who Wants To Be Watched What A Slut vol. 002

  • censoredcreampieuniformBAZXbazookatodoBAZX-266BAZX266h-1496bazx00266
    • 2021-01-19
    26 min

    FC2PPV 1651577 [Personal shooting] Beautiful office lady at the reception desk of the company ・ Because of debt repayment, she gets vaginal cum shot four times in a row and gets sweaty.

  • amateur uncensoredfc2
    • 2021-01-24
    81 min

    345SIMM-595 Super innocent idol face J ○ rushes into the family-less toilet in search of Ochi ○ Po! Erotic videos are blackmailed (laughs) by a horny slut who loves sex very much, and hotein → camera soaked laser tide is shot! The inside, mouth, and

  • amateur censoredcreampiesquirtingsimmsimm-595simm595345simm-595
    • 2021-01-25
    17 min

    FC2PPV 1659037 Until 28th 980pt → 580pt [Personal shooting] Thick fucking soggy blowjob mouth launch from midday with a slender young wife

  • amateur uncensoredfc2
    • 2021-02-06
    120 min

    [JUL-459]She's Got Brains And Beauty - Hot MILF Madonna Exclusive Part 3! Your Mom's Friend Mayuka Kitagawa

  • mayuka kitagawa censoredbig titsmature womanJULmadonnajyoji kawaiJUL-459JUL459jul00459
    • 2021-02-13
    134 min

    [KYMI-011]Self Shots: Fucked With Dirty Talk - Clothed Slut

  • tsukasa nagano wakamiya censoredslutKYMImiluaida yumenoKYMI-011KYMI011kymi00011
    • 2021-02-20
    89 min

    FC2PPV 1694976 [First time limited 1980] Former CA beautiful wife of entertainer level ❤️ Secret meeting of adult in the daytime of the next day ❤️ Transcendence outside and inside of bewitching body 60 Ikase ❤️ Throat back Irama ❤️ Vaginal back seed

  • amateur uncensoredfc2
    • 2021-02-27
    119 min

    [MIDE-893]Salon de Slut: Beauty Salon Welcoming Hard Dicks With Sweet Whispers And Colossal Tits - Fumika Nakayama

  • nakayama fumika censoredbig titsslutMIDEmoodyzsamoarimoodyz divaMIDE-893MIDE893mide00893
    • 2021-03-04
    244 min

    [CVDX-438]She'll Suck Up Every Last Drop Of Semen!! Immediately After Orgasmic Creampie Sex, This Horny Old Lady Will Follow Up With A Cleanup Blowjob On His Sensitive Cock 30 Ladies 4 Hours

  • censoredcreampieblowjobCVDXcenter villageCVDX-438CVDX438h-086cvdx00438
    • 2021-03-12
    202 min

    [BAZX-279]Working Girl Wants To Get Choked. vol. 002

  • censoredcreampieuniformBAZXbazookatodoBAZX-279BAZX279h-1496bazx00279
    • 2021-03-18
    184 min

    [PPPD-915]"For Everyone Who Wants To Cum While Smothered In Tits!" Squished Between Dual Pairs Of Great Boobs In A Creampie Massage Parlor Three-Some

  • haruna hana maki kyoko censoredcreampiebig titsPPPDoppaiPPPD-915PPPD915pppd00915
    • 2021-03-19
    131 min

    [TSF-016]You're A Band Musician, But When You Wake Up In The Morning, You Discover That You've Been Transformed Into A Woman (21) A Thorough Investigation "I'm Telling You, I'm A Guy!" I Tried To Resist, But Once I Realized H

  • wataru okamura censoredcreampiebeautiful girlTSFkaguyahimept mousouzokugynecomastia reportTSF-016TSF016tsf00016
    • 2021-03-30
    69 min

    326PAPA-029 [Daddy activity x minor x Saddle tide injection] [Two consecutive shots in the mouth & vagina] Professional-grade daddy activity girls advent who are making a rough profit with a father killing blowjob! Unauthorized vaginal cum shot to

  • amateur censoredcreampiesquirtingpapapapa-029papa029326papa-029
    • 2021-03-30
    56 min

    491TKWA-077 A delicate little girl and a lovely SEX that breaks when hugged

  • amateur censoredamateurtkwatkwa-077tkwa077491tkwa-077
    • 2021-04-03
    125 min

    [TSF-017]Male Office Worker (Age 24) Wakes Up One Morning To Find Himself Transformed Into A Woman - The Stud She Meets On A Dating App Awakens Her Pussy And Transforms Her Into A Raging Slut Kenji Mizuta

  • kenji paddy censoredcreampiecosplayTSFkaguyahimept mousouzokugynecomastia reportTSF-017TSF017tsf00017
    • 2021-04-08
    210 min

    [ABW-079]【MGSだけのおまけ映像付き 20分】風俗タワー 性感フルコース3時間SPECIAL ACT.34 天然H乳

  • amateur censoredbig titssquirtingabwabw-079abw079abw-079
    • 2021-04-08
    128 min

    [IENF-135]This Elder Sister Type Provides Men With A Business Trip Massage, But She Hasn't Met Anyone Good In Years, And Now She's Super Horny And Down To Fuck! When She Touches Men's Bodies, It Makes Her Throb With Desire, So When I Slip

  • misuzu kawana natsuho imai censoredcreampieIENFi energytiger gavelienfIENF-135IENF1351ienf00135
    • 2021-04-09
    134 min

    [MIDE-909]I Was Confined In The Room Of A Classmate I Hate And Not Even Allowed To Use The Bathroom... Mia Nanasawa

  • nanasawa mia censoredblowjobbeautiful girlMIDEmoodyzhiromichi hosemoodyz divaMIDE-909MIDE909mide00909
    • 2021-04-20
    139 min

    [VNDS-5210]An Exquisite Mature Woman Hitomi Enjoji A Mind-Blowingly Ripe Body

  • hitomi enjo censoredcreampiebig titsVNDSstar paradisenext toilet r eVNDS-5210VNDS5210h-254vnds05210
    • 2021-04-21
    44 min

    FC2PPV 1780213 [Personal shooting] ♀ 242 Apparel clerk ◯ Ochan 20 years old 5th time boobs, ma ◯ Ko bare no bra, no panties J system costume to conceive an H cup big breasts girl with genuine vaginal cum shot!

  • amateur uncensoredfc2
    • 2021-04-30
    257 min

    [HEZ-275]Street Pick Up Of First Class Hot Celeb Mature Chick w/ Creampie Finish 29

  • censoredcreampiebig titsHEZhot entertainmentstudio zerohot premium rose docuHEZ-275HEZ27559hez00275
    • 2021-05-18
    41 min

    299EWDX-361 Egg skin of unknown age Pururun fair-skinned wife’s lively face is rough and erotic!

  • amateur censoredmarried womansquirtingewdxewdx-361ewdx361299ewdx-361
    • 2021-05-18
    139 min

    [STARS-364]Sirently Ravished - You Can't Make A Sound... You Can't Tell A Soul While She Rides You And Whispers In Your Ear, Then Makes You Cum. Mahiro Tadai

  • mahiro yui censoredbeautiful girlslutSTARSsod createhideyuki shinboSTARS-364STARS3641stars00364
    • 2021-05-28
    42 min

    480FRIN-034 Atami Ryokan User Couple Secretly Hidden Camera [Libido Satisfaction Wife H Cup 27 Years Old]

  • amateur censoredcreampiebig titsfrinfrin-034frin034480frin-034
    • 2021-06-04
    711 min

    [PRED-317]If You Can Provide Yuki Takeuchi With The Best Masturbation Instructions She'll Let You Fuck Her Raw As Soon As Work From Home Has Ended!

  • yuki takeuchi censoredcreampiesingle workPREDpremiumzampaelegancePRED-317PRED317pred00317
    • 2021-06-06
    59 min

    HEYZO 2543 Busty Married Wife’s Affair Vol.3 – Ayane Yuuki

  • ayane yuuki uncensoredcreampieheyzo
    • 2021-06-20
    240 min

    [MKMP-404]SUPER COMPLETE BEST Aoi Kururugi

  • aoi kururugi censoredcreampiebeautiful girlMKMPkm producetaro kmillionMKMP-404MKMP404mkmp00404
    • 2021-06-22
    58 min

    499NDH-024 Mouth Service is the Best Proof of Love! Axillary, navel, fingers, rimming, licking and sucking large-scale behavior! Saddle tide dripping raw Saddle hope Ma ○ Ko is pierced with a gun and facial cumshots on a too licking beauty who expres

  • amateur censoredcreampiesquirtingndhndh-024ndh024499ndh-024
    • 2021-06-26
    132 min

    [SQTE-373]Who Did This!？ Beautiful Girl Narumi, Plowed To The Depths Of Her Throad - Narumi Hirose

  • narumi hirose censoredcreampiebeautiful girlSQTEs cuteSQTE-373SQTE373sqte00373
    • 2021-07-03
    120 min

    [MEAT-033]Amazing Ass: Record Of Adultery - A Celebrity Wife Who Likes To Be Filmed - Sumire (32)

  • censoredMEATbig fleshy road family daydreamMEAT-033MEAT033meat00033
    • 2021-07-14
    126 min

    [SSIS-128]Mixed Body Fluids, Deep Sex - Completely Uncut Special - Konan Koyoi

  • koyoi konan censoredbig titssingle workSSISs1 no 1 stylemichiru arashiyamaSSIS-128SSIS128ssis00128
    • 2021-07-17
    75 min

    FC2PPV 1927776 G-Cup Girl, Raw Saddle "Personal Shooting" Individual Shooting Completely Original 122nd Person While Enrolled In March At A Famous University

  • amateur uncensoredfc2
    • 2021-07-30
    236 min

    [HUNTB-071]Fucking my best friend"s girlfriend all night! She doesn"t want to leave and hides from her boyfriend when he picks her up the next day... "Forget about last night..."

  • censoredcreampieHUNTBhunterspace nyan jirohhh groupHUNTB-071HUNTB071huntb00071
    • 2021-07-30
    142 min

    [RBK-019]She Wanted To Party, And Ended Up At The Dumpy Home Of A Stinky Dirty Old Man. Her Mind Was Cloudy, But As She Got Fucked, This Young Lady Began Her Descent Into Cum Bucket Pleasure. Hikari Ninomiya

  • hikari ninomiya censoredbeautiful girlsingle workRBKattackersjo styleryuu bakuRBK-019RBK019rbk00019
    • 2021-08-04
    109 min

    474MUSUME-007 Rin

  • amateur censoredcreampieuniformmusumemusume-007musume007474musume-007
    • 2021-08-06
    49 min

    FC2PPV 1960512 ★ 1,280pt Until 8/15 (Sun) For A Limited Time !! [No / Individual] Active Jd (21) With Strong Libido And Echi Echi Soft Body Gonzo ♪ Naked Y-Shaped Balance & Split Split To See The Dick! !! !! * High-Quality Review Benefits Availabl

  • amateur uncensoredfc2
    • 2021-09-02
    54 min

    494SIKA-105 Miraculous Gully Small Tits Beautiful Girl Aheiki In The First 3p

  • amateur censoredschoolgirlamateursikasika-105sika105494sika-105
    • 2021-09-03
    119 min

    [MIMK-094]The Process Of Getting A Quiet, Secretly Horny Girl Hooked On Sex With Middle-Aged Men Her Holes Are Made For Plugging By Middle-Aged Dirty Old Men A New Episode, Just Added, Of This Super Popular Comic That Has Given Erections To 20,000 Fa

  • satsuki mei censoredcreampieuniformMIMKmoodyzdoragon nishikawamankitsuMIMK-094MIMK094mimk00094
    • 2021-09-10
    91 min

    [VEC-493]My Friend"s Mother Wants To Take My Virginity! About To Get Smothered! First-Ever Big Ass Facesitting Sex. Chiharu Ito

  • chiharu ito censoredcreampiemature womanVECvenuspetermegami venusVEC-493VEC493vec00493
    • 2021-09-22
    37 min

    FC2PPV 2235170 [36 Minutes Uncut / 4 Shots] Yurufuwa Female College Student Ayano-Chan (21) Is Finally Turned. Uncut Creampie Cum ＃ 16

  • amateur uncensoredfc2
    • 2021-09-25
    144 min

    [JKSR-510][Leaked Video] S********l School Team Dorm Fuck 5, G*******g, Night Visit, Threesome, Bath, Changing Room Peeping... So Many Dirty Videos

  • censoredamateurbeautiful girlJKSRbig mocalobockeypink junkieJKSR-510JKSR51057jksr00510
    • 2021-10-12

    H0930 ki211012 Harumi Tanaka 35years old

  • amateur uncensoredh0930
    • 2021-10-13
    120 min

    [268SPYE-274]隠し撮り投稿 変態おやじがあとでこっそり見るように撮りためた卑猥映像集 2

  • amateur censoreduniformamateurspyespye-274spye274268spye-274
    • 2021-10-21
    120 min

    [ARSO-21151]My Wife -Celeb Club- 151

  • rika matsuyama yoshino matsumiya censoredARSOaroundkiiroi hyouARSO-21151ARSO21151h-1378arso21151
    • 2021-10-22
    119 min

    [JUL-756]My Bully Fucked My Mom Asahi Mizuno

  • mizuno chaoyang censoredbig titsmature womanJULmadonnakawaijou osamuJUL-756JUL756jul00756
    • 2021-11-08
    33 min

    FC2PPV 2412767 Limited Number! [Uncensored] Innocent School Ponytail Black-Haired Female College Student! Pretty Looks But Tight Bristles … I Can’t Help But Feel Embarrassed And Cum Inside "Part 2"! !! (Blow Scene Appearance)

  • amateur uncensoredfc2
    • 2021-12-04
    74 min

    FC2PPV 2486345 An S-Class Beautiful Girl From A National Idol. She Released The Overwhelming Transparency That Was Active In Tv And Commercials, And The Miracle Gonzo That Played With The Body Of A Fair-Skinned Slender As Much As She Wanted.

  • amateur uncensoredfc2
    • 2021-12-08
    36 min

    490FAN-112 [Cum Massage] Oil With Aphrodisiac On A Slender Body With Beautiful Legs. I Can’t Stand It And It’s Raw.

  • amateur censoredamateurbukkakefanfan-112fan112490fan-112
    • 2021-12-10
    120 min

    [IPX-782]24-Hour Mouth Ejaculation Available With Mobile Nurse Call! Precocious Pacifier Nympho Nurse. Tsumugi Akari

  • akari tsumugi censoredblowjobbeautiful girlIPXidea pocketsuisei akaidishIPX-782IPX782ipx00782
    • 2021-12-10
    120 min

    [SSIS-267]110 Furious Orgasms! 4800 Spasms! 2000cc Of Cum Squirts! An Innocent Barely Legal Babe Is Getting Initiated With A Big Dick And Experiencing An Eros Company Awakening Her First Massive, Spasmic, Orgasmic Special Nanami Ogura

  • nanami ogura censoredbig titsbeautiful girlSSISs1 no 1 styleichigoharaSSIS-267SSIS267ssis00267
    • 2021-12-17
    123 min

    [TPPN-214]Hikari Hii"s First Attempt, Uned, Unacted, Instinctive Real Intercourse, Sweaty Oni-pis And Her First Climax!

  • hikari hime censoredcreampiebig titsTPPNteppanTPPN-214TPPN214tppn00214



    • Japan xxx, japanese adult videos, japani sexy, Japanese Adult Movies, JAV censored, Japanese tube, Japanese sex online