jav best omnibus nampa amateur high vision




FC2VEMAABWMIDEAUKSNGODCESDHODVHUNTBAWDMIDVWAAASPRDMVSDSHKDSSISMEYDAUKGKSBJJUFEAMBI

2020-12-26
138 min

[MMND-193]"I Can't Do Porn" Miku Maina, Colossal 103 cm J-Cup Tits! Real Bilingual Female Teacher

  • maina miku censoredbig titssingle workMMNDmimanyuki iwasawaMMND-193MMND193mmnd00193
    • 2020-12-29
    88 min

    261ARA-469 [High-voltage 1 million volt beauty] 26 years old [Current bilibili continuous climax] Toki-chan is here! The reason for her application for the marriage scam is “I want to have sex with the feeling that I’m squirming to God ♪

  • amateur censoredbig titsamateuraraara-469ara469261ara-469
    • 2021-02-12
    119 min

    [IPX-615]Polite Dirty Talk - Massage Parlor Slut Sweetly Teases You With Her Lingerie - You Can't Leave Until You Cum Tsubasa Amami

  • amami tsubasa censoredcreampieslutIPXidea pocketzaku araidishIPX-615IPX615ipx00615
    • 2021-02-21
    122 min

    [DASD-818]The Golden Shower Domain This Sch**lgirl Was Receiving Breaking In Piss Training By A Teacher With Abnormal Sexual Hangups And Now She's Dribbling Her Holy Waters Down Her Crystal Pure Thighs Mao Watanabe

  • mao watanabe censoredcreampiesquirtingDASDdassDASD-818DASD818dasd00818
    • 2021-02-28
    124 min

    [JJBB-006]We Heard About This Mature Woman Pink Salon Where The Ladies Were Loose And Easy, So We Decided To See How Far We Could Go 06

  • censoredcreampiemature womanJJBBjukujo japanJJBB-006JJBB006jjbb00006
    • 2021-03-05
    240 min

    [FIV-077]The Essence Of Eroticism 3 ~ Big Titty Special! We Love One Night Stands! Revealing The Sexy Truth About Modern Girls!

  • censoredbig titsamateurFIVprestigefive starsFIV-077FIV077118fiv00077
    • 2021-03-07
    43 min

    490FANY-24 Karin 4

  • amateur censoredamateurfanyfany-24fany24490fany-24
    • 2021-04-07

    FC2PPV 1757191 Up to 11 [Appearance] Private general course ③ Creampie in big breasts who went on to specialize in voice actors of anime voice

  • amateur uncensoredfc2
    • 2021-04-07
    120 min

    [MSA-016](Amateur Videos) (Creampie Raw Footage) 16 A Massive Semen Flood Into Her Shaved Pussy Without Permission! She Looks Just Like That Famous Gravure Idol Yuki-chan Is A 22-Year Old Colossal Tits JD! I Love Her Black Hair Bangs And Her Pigtails

  • censoredcreampieamateurMSAfuturefuture futureMSA-016MSA016
    • 2021-04-15
    240 min

    [NASH-493]Mama, Please Lick My Peepee... Twisted Love Between Stepsons And Mature Their Stepmoms - Doted On By 12 Voluptuous Cougars In Their Fifties, 4 Hours

  • censoredcreampiebig titsNASHpinknadeshikoNASH-493NASH493nash00493
    • 2021-04-21
    60 min

    FC2PPV 1780259 Relieve self-restraint and release stress for both men and women! Continuous vaginal cum shot!

  • amateur uncensoredfc2
    • 2021-04-28
    51 min

    FC2PPV 1792607 A fresh slender girl who just came to Tokyo ❤️ First and last intense Gonzo video [Personal shooting]

  • amateur uncensoredfc2
    • 2021-05-01
    115 min

    [RBK-012]The Tragic Super High-Class Raw Sex Soapland Lady Michiru Kyujo

  • kujo michiru censoredsingle workRBKattackerseitaro hagaeryupakuRBK-012RBK012rbk00012
    • 2021-05-14
    35 min

    359TYVM-155 My grandson is also surprised Shakuhachi Tech 60th birthday Ma ● Co with sperm exploitation mass cum shot! !!

  • amateur censoredcreampiemarried womantyvmtyvm-155tyvm155359tyvm-155
    • 2021-05-20
    164 min

    [SW-777]"Are You Still A Cherry Boy？ What A Joke. Well Then, I'm Very Experienced In Sex, So Shall I Help You Graduate？" My C***dhood Friend Had Grown Up To Become A Slutty Bitch, And She Laughed At Me, Showing Off Her Panties And Titties

  • censoredSWswitchlight fujimaswitch switchSW-777SW7771sw00777
    • 2021-05-21
    60 min

    494SIKA-089 Make A Pet Of A Countryside De M Kyaba

  • amateur censoredcreampieamateursikasika-089sika089494sika-089
    • 2021-06-14
    69 min

    491TKWA-003 Shiori

  • amateur censoredcreampieamateurtkwatkwa-003tkwa003491tkwa-003
    • 2021-06-19
    121 min

    [HND-997]This Temporary Worker Is An Unlucky Girl Who Only Makes 170,000 Yen Per Month, But The Truth Is That She Has A Powerful Sex Drive And The Only Thing She Was Looking Forward To Was This Adult Video Shoot, And Now She's Making Her Bashful

  • nagisazawa censoredcreampieblowjobHNDhon nakabacon tanakaHND-997HND997hnd00997
    • 2021-06-28
    65 min

    SIRO-4527 [First shot] [Beautiful busty college student] [Best fucking service] Active JD who enjoys college life likes sex. She shakes the beautiful big tits of the H cup and dies many times on her big cock .. Application amateur, her first AV shoot

  • amateur censoredbig titsamateursirosiro-4527siro4527siro-4527
    • 2021-07-01
    60 min

    Pacopacomama 070121_497 Secret with the wife next door Reiko Shibata

  • amateur uncensoredpacopacomama
    • 2021-07-02
    238 min

    [TSP-444]Ravished In Pitch Darkness... Solo Camping Raids: Fucked In Their Tents "What... Why Isn't My Body Moving？!"

  • censoredcreampieTSPtokyo specialmanji groupTSP-444TSP444tsp00444
    • 2021-07-17
    150 min

    [JUL-660]A Drama Without Dialogue: No Words Needed, This Is The Ultimate Adulterous Sex Where Everything Is Told Through The Eyes And Fingers - Ayaka Mutou

  • ayaka muto censoredmature womansingle workJULmadonnanao masakiJUL-660JUL660jul00660
    • 2021-07-17
    118 min

    [JUL-658]Creampies And G*******gs Every Day For An Eternity. Rin Okae

  • rin okae censoredcreampiebig titsJULmadonnaunicorn fukudaJUL-658JUL658jul00658
    • 2021-07-19
    65 min

    HHSI-005 Karen

  • amateur censoredamateurhhsihhsi-005hhsi005hhsi-005
    • 2021-07-23
    124 min

    [NCYF-012]Seven People In A Wild Orgy: Otherworldly Petite Fairy Cosplayer With A 140 cm Tall Body Has Her Innocent Tight Pussy Destroyed By Thick Rods. "Shaved Pussy Breaching With Spraying Squirt", "Mixed Cum Pregnancy Experiment",

  • censoredcreampiesquirtingNCYFall japan amateur photographers union daudagawaNCYF-012NCYF012ncyf00012
    • 2021-08-20
    180 min

    [VNDS-7088]Picking Up Cougars At A Bar And Taking Them Home For Raw Sex, 180 Minutes

  • censoredblowjobVNDSstar paradisenext11VNDS-7088VNDS7088h-254vnds07088
    • 2021-09-03
    122 min

    [CAWD-277]When CAMPING By Herself For The First Time, She Gets Fucked By A Camper Who Is A Teaching Freak... Moko Sakura

  • sakura moko censoredcreampiesingle workCAWDkawaiinemuemoCAWD-277CAWD277cawd00277
    • 2021-09-09
    139 min

    [HBAD-594]A Filthy Young Wife Who Secretly Started An Apartment Building Call Girl Service From Her Home Her Husband Had Awakened To The Pleasures Of Cuckold Fantasies And Enjoyed Watching Her Get Fucked And So They Both Got A Taste Of Orgasmic Pleas

  • lyra takizawa censoredsingle workHBADhibinonamitaro umababeHBAD-594HBAD5941hbad00594
    • 2021-09-11
    110 min

    [NSFS-025]The Boss And His Wife Underling 16 - An Evil Boss, Up To His Neck In Corruption And Shame, Lays A Trap - Jun Harumi

  • jun shunmei censoredsingle workdramaNSFSnagae stylenagaeNSFS-025NSFS025nsfs00025
    • 2021-09-16
    65 min

    336KNB-172 AV Appearance To Release The Sexual Desire That The Small Devil Wife Has Accumulated. If You Insert It Slowly Into The Vagina, You Will Tighten Naka Tightly And Cum Many Times! !! 65 At Kobuchi Station, Sagamihara City

  • amateur censoredmarried womanamateurknbknb-172knb172336knb-172
    • 2021-09-17
    131 min

    [JUFE-327]The Return!! A 1-Year Anniversary The Cum Swallowing Ban Has Been Lifted A 10-Cum-Shots-In-A-Row 127-Minute Non-Stop Sex Filming Session Rena Momozono

  • reina taoyuan censoredbig titssingle workJUFEfitchkirinJUFE-327JUFE327jufe00327
    • 2021-09-17
    120 min

    [PRED-340]My Senior Riona Who Is Famous For Her Beauty Became My Personal Cock Sucker And It Is A Secret Between The Both Of Us Riona Hirose

  • rio hirose censoredblowjobslutPREDpremiumakai suiseielegancePRED-340PRED340pred00340
    • 2021-09-17
    124 min

    [PPPD-963]Cum Loving Slut With Soft Tits Enjoys A Titty Fuck. Total Course Of Sticky Loads For Cum Swallowing. Honoka Tsujii

  • tsujii honoka censoredbig titsslutPPPDoppaiPPPD-963PPPD963pppd00963
    • 2021-09-30
    90 min

    FC2PPV 2274183 At The Age Of 19, It’s Been A Few Months Since My First Experience! First Shot Despite Being Inexperienced! Genuine Active Model, Active Female College Student, Complete First Shooting, 170 Cm, G Cup "Personal Shooting" In

  • amateur uncensoredfc2
    • 2021-10-02
    46 min

    H0930 ori1613 Saaya Murabe 26years old

  • amateur uncensoredh0930
    • 2021-10-04
    60 min

    541AKYB-004 Manami (19) G Cup Daughter Medium ○ ♪ (Madoka Susaki)

  • amateur censoredcreampiebig titsakybakyb-004akyb004541akyb-004
    • 2021-10-23
    239 min

    [NANX-239]Picking Up Amateur Housewives!! "I Feel Guilty About My Husband" She Says As She Meets A Guy With A Big Dick For Intense Fucking. Wives With Big Tits.

  • censoredcreampiebig titsNANXk m producenanpa heavenNANX-239NANX239nanx00239
    • 2021-10-25
    34 min

    FC2PPV 2372099 Prefectural Girls’ School ② F Cup Erotic Daughter. Knowing The Value Of Your Body High ○ Debut * Limited To 100

  • amateur uncensoredfc2
    • 2021-11-16
    34 min

    FC2PPV 2437827 Limited * The Latest [Virgin Paco Bus Tour] This Fall! There Is Anything You Want To Do With Vaginal Cum Shot [cen]

  • amateur uncensoredfc2
    • 2021-11-16
    76 min

    299EWDX-388 G Cup Big Breasts Wife’s Healing Fucking Famous Instrument Ma Co ○ Cum Inside Raw Saddle

  • amateur censoredcreampiebig titsewdxewdx-388ewdx388299ewdx-388
    • 2021-11-20
    234 min

    [GIGL-668]Thank You For Picking Me Today. I"m A Good Married Woman Who Will Let You Fuck Her If You Make Her Feel Like It.

  • censoredcreampiemarried womanGIGLgigolopermaGIGL-668GIGL668gigl00668
    • 2021-11-22
    55 min

    FC2PPV 2455171 I Can Meet Again! !! Jd Is Studying To Become A Kindergarten Teacher. Perfect Girl Is The Second Vaginal Cum Shot ♪

  • amateur uncensoredfc2
    • 2021-11-25
    125 min

    [FSDSS-318]"Are You Interested In My Breasts？" Getting Hard As She Made Fun Of Me, I Ended Up Having Some Titty Fucking SEX With My Big Breasted Senior - Yuko Ono

  • yuko ono censoredbig titsdramaFSDSSfalenoshrimpfaleno starFSDSS-318FSDSS3181fsdss00318
    • 2021-11-27
    99 min

    [MDVHJ-042]Night Visit Lesbians who are Mother-in-Law and Daughter-in-Law, Chapter 6

  • ryo fukutomi takanashi arisa censoredbig titslesbianMDVHJgurafiteijapanmovieMDVHJ-042MDVHJ04248mdvhj00042
    • 2021-12-04
    53 min

    C0930 hitozuma1368 Fusako Yokoyama 29years old

  • amateur uncensoredc0930
    • 2021-12-09
    180 min

    [SVDVD-893]Christmas Party Fucking! We Pretend To Be S*****ts And Bring Lonely S********ls To A Christmas Party To Tie Up And Fuck! Water Play! Deep Throating! Finishing Them Off With Vibrators! Sex Crazed Sluts Covered In Cum And Spit Invite Their F

  • natsu tojo narita tsumugi censoredcreampiesquirtingSVDVDsadistic villagekannana dainanakanmusumeSVDVD-893SVDVD8931svdvd00893
    • 2021-12-17
    123 min

    [DAVK-069]"The Smell Of An Older Guy Excites Me..." Secretly Perverted Neat And Clean Beautiful Girl French Kisses Middle-age Guys, Tongue Cleans Chubby Bodies, Swallowing Entire Big Dick For A Blowjob And Deep Throat Cum Load, Non-stop Cowgi

  • censoredcreampieuniformDAVKtmatakashi hashidadoujin av clubDAVK-069DAVK06955davk00069
    • 2022-01-07
    60 min

    329EXMU-075 Rina-chan (Rina Takase)

  • amateur censoredcreampieschoolgirlexmuexmu-075exmu075exmu-075
    • 2022-01-08
    92 min

    300MAAN-733 [Obedient De M Pet Beautiful Girl] [Herbivorous Boyfriend Possession] [There Is A Complex In The Etch] [Ubu Butt Prep] [I Feel Hit] [Hidden De M Propensity Bare] [Squirting Iki Rolled Sex !! !! ] -I Brought Geki Ubu-Chan. ＃ 05 ～ (Ayami Em

  • amateur censoredcreampiesquirtingmaanmaan-733maan733300maan-733
    • 2022-01-09
    105 min

    390JNT-034 [4D Nipples] I ● Put An Erotic Selfie On The Star, Pick Up An F Cup Yakiniku Shop Clerk On SNS! !! 4d Nipples That Pop Out And Have Outstanding Sensitivity! Slender Busty Body That Combines Beautiful Big Tits And Plump Peach Butt Cums Conv

  • amateur censoredcreampiebig titsjntjnt-034jnt034390jnt-034
    • 2022-01-13
    130 min

    [IESM-064]Yuki Mishima. A Green Light For S&M. Hardcore S&M Breaking In To Awaken Her Total Masochism.

  • yuki mishima censoredcreampiebdsmIESMienergykikuriniesmIESM-064IESM0641iesm00064
    • 2022-01-15
    124 min

    [DPMI-066]Race Queen Lovers - Megu Mio

  • mio meg censoredsingle workDPMImirudopamixDPMI-066DPMI066dpmi00066
    • 2022-01-21
    141 min

    [DASD-961]Popular Sluts At School Fall In Love With My Unpopular Dick Yuri Fukuda Rika Tsubaki

  • yuri fukada tsubaki rika censoredbig titsuniformDASDdasrokusaburo mishimaDASD-961DASD961dasd00961
    • 2022-01-25
    42 min

    Pacopacomama 012522_598 Beautiful Escort Services MINORI

  • amateur uncensoredpacopacomama
    • 2022-01-29
    113 min

    [420POW-054]ぱるよ【素人ホイホイpower／ハメ撮り／十代／美少女／清楚／女子校生／制服／素直／巨乳／Iカップ／バスト100cm／ローション・オイル／ウブな反応／経験人数1人】

  • amateur censoredbig titsschoolgirlpowpow-054pow054420pow-054
    • 2022-02-01
    135 min

    [DOKS-553]Her Pharynx Caves In. Breaking In A Beautiful Girl For A Throat-Denting Face-Fucking. The Totally Perverted Masochistic Girl Starts Peeing At Once. Atsuko Nakajima. 22 Years Old.

  • atsuko nakajima censoredblowjobbeautiful girlDOKSoffice k somutsu sukebeiDOKS-553DOKS55336doks00553



    • Japan xxx, japanese adult videos, japani sexy, Japanese Adult Movies, JAV censored, Japanese tube, Japanese sex online