jav beautiful girl creampie breasts censored




FC2RBDPREDLULUGVHAVSAHNDAWDMILKSTARSSQTESSNISDABROYDAMBIDTTAPODCHRVCJODFSDSSDASD

2020-12-13
151 min

[CHRV-122]My Little Stepsister Is A Shoplifter Who Hides Her Stolen Wares In Her Cleavage, But She Didn't Realize That Hot Shoplifters Get Fucked! B Is For Busted! L Is For Loose Socks! T Is For Thong! My Little Stepsister Has Big Tits Worth More

  • censoredcreampiebig titsCHRVcherry revolution daydream tribecherry s reboCHRV-122CHRV122chrv00122
    • 2020-12-24
    51 min

    [NYH-079]Passion For Young Boys: Mom's Sex Education - Hotaru Mori

  • hotaru mori censoredbig titsmilfNYHdirectorsdirectorsnyanjiang houseNYH-079NYH0791nyh00079
    • 2020-12-26
    119 min

    [MIDE-867]Premature Ejaculations, Convulsions And Orgasms Sp. Mizuki Aime

  • mizuki ai censoredsquirtingsingle workMIDEmoodyzzaku araimoodyz divaMIDE-867MIDE867mide00867
    • 2021-01-05
    45 min

    FC2PPV 1633088 [Personal shooting] 20-year-old fair-skinned beauty CA aspiring JD ♡ ~ Pa ○ active beginner’s vagina back unauthorized vaginal cum shot ~

  • amateur uncensoredfc2
    • 2021-01-08
    482 min

    [HEZ-242]HOT ENTERTAINMENT The Top-Ranked Mature Woman Titles Sold On The Internet 8 Hours Collector's Edition

  • censoredcreampiebig titsHEZhot entertainmentobachHEZ-242HEZ24259hez00242
    • 2021-01-08
    175 min

    [SW-750]I Couldn't Pay The Rent, So I Crashed At My Girlfriend's Place And She Kindly Took Me In, And Now I'm Living A Dream-Cum-True Life With Her 3 Big Tits Sisters!!

  • censoredbig titssisterSWswitchcambridgeswitch switchSW-750SW7501sw00750
    • 2021-01-24
    55 min

    285ENDX-322 A 20-year-old female college student who runs out of vaginal cum shot twice! I’m 100 times wetter than usual at the woman on top posture that I can insert from myself!

  • amateur censoredcreampieamateurendxendx-322endx322285endx-322
    • 2021-01-29
    67 min

    383REIW-026 Yukino

  • amateur censoredcreampiebig titsreiwreiw-026reiw026383reiw-026
    • 2021-02-16
    44 min

    S-Cute tat_072 Gonzo out of a naive girl with an innocent face / Aoi

  • amateur censoredcreampieamateurtattat-072tat072tat-072
    • 2021-02-22
    133 min

    [SRMC-029]It Can't Be True That You Can Make Sex Feel 100 Times Better Just Through The Power Of Suggestion! 2 Mizuki Yayoi

  • mizuki yayoi censoredsquirtingbeautiful girlSRMChypnosisrusher miyoshiSRMC-029SRMC029srmc00029
    • 2021-02-27
    117 min

    [WAAA-041]Overwhelming G-Spot Sex, Driven By Insane Jealousy Breaking In A Bitch With Direct Thrusts Of Piston-Pounding Pleasure To Blow Her Mind I Used To Love My C***dhood Friend, And Now I'm Relentlessly Impregnating Her With NTR Sex Rika Aimi

  • rumi tadami censoredcreampiedeepthroatWAAAwanz factorywanzWAAA-041WAAA041waaa00041
    • 2021-02-27
    239 min

    [MCSR-429]A Beautiful Amateur Mature Woman Gets Seduced Meet Horny Wives Who Cannot Let Go Of Their Lust! Hey Ma'am, Please Get My Dick Hard!! Total Creampie Sex 11 Ladies 4 Hours

  • censoredcreampieamateurMCSRbig morkalguo masumascottMCSR-429MCSR42957mcsr00429
    • 2021-03-03
    80 min

    374IMGN-001 Madoka

  • amateur censoredcreampiebig titsimgnimgn-001imgn001374imgn-001
    • 2021-03-09
    123 min

    [KTRA-279]A Limber-Limbed Slender Little Stepsister Gets Her Shaved Pussy Creampie Fucked Karen Junshin

  • innocent karen censoreduniformbeautiful girlKTRAk tribeKTRA-279KTRA279h-094ktra00279
    • 2021-03-12
    108 min

    [XRW-986]Breaking In A Bitch - Aoi Tojo

  • tojo censoredcreampieblowjobXRWreal worksreal real worksXRW-986XRW986172xrw00986
    • 2021-03-19
    47 min

    FC2PPV 1671733 [Personal shooting] Appearance / Miya 20 years old / I’ve been doing all-you-can-eat, raw squirrel, and vaginal cum shot to a fair-skinned girl with big dicks! !!

  • amateur uncensoredfc2
    • 2021-04-01
    79 min

    [REBD-546]Nako: The First Dazzling Star - Nako Hoshi

  • nako hoshi censoredsingle workREBDrebeccakure hagaREBD-546REBD546h-346rebd00546
    • 2021-04-03
    46 min

    188HINT-0449 Shoko (Shoko Tokuyama)

  • amateur censoredcreampiesquirtinghinthint-0449hint0449188hint-0449
    • 2021-04-09
    119 min

    [IPX-645]Unsatisfying Call Girl Made To Put Out. Ravished With Nine Creampie Loads! Yume Nishimiya

  • yume nishinomiya censoredcreampiesingle workIPXidea pocketinaballdishIPX-645IPX645ipx00645
    • 2021-04-14
    211 min

    [HUNTA-997]The Girl I Had A Crush On In School Has Transformed Into A Wild Slut？! We Met Again At Our Class Reunion And After A Little Liquor The Hottest Girl School Came Back To My Place. Only Now She's Even Hotter...

  • censoredblowjobHUNTAhunterspace nyanjirohhh groupHUNTA-997HUNTA997hunta00997
    • 2021-04-16
    131 min

    [HZGD-185]My Neighbor Is A Massage Parlor Therapist And She Sensually Aroused Me And Fucked My Brains Out, Because She's A J-Cup Titty Beautiful Squirting Housewife Babe With Colossal Tits Chitose Yuki

  • chitose in the evening censoredcreampiebig titsHZGDmarried woman flower garden theaterhirokoji osakiimage married woman flower garden theatHZGD-185HZGD185h-1100hzgd00185
    • 2021-04-17
    119 min

    [JUL-550]I Work For A Housecleaning Service, And I Was Sent To The Home Of The Worst Bad Boy In The Neighborhood. Marika Kobayashi

  • marika kobayashi censoredcreampiemature womanJULmadonnaunicorn fukudaJUL-550JUL550jul00550
    • 2021-04-27
    102 min

    261ARA-486 [Nutrition (SEX) deficiency] 30 years old [Big tits and fair body] Yumina is here! She is a registered dietitian at the hospital. The reason for her application is "High protein. I want to have a high calorie etch …" She says

  • amateur censoredbig titsamateuraraara-486ara486261ara-486
    • 2021-05-02
    88 min

    345SIMM-640 Dirty Big Tits Glasses J ○ And Hot Affair! I was groped with H milk and spilled holy water from my mouth! Self-milk licking is also good! !! The sexual power of 530,000 Kansuto Hentai-chan, whose fighting ability is too cute, is here! !!

  • amateur censoredcreampiebig titssimmsimm-640simm640345simm-640
    • 2021-05-07
    175 min

    [NHDTB-525]Faithless Wife In Sexy Lingerie Seduced The Hung Neighbor Next Door And Now He Won't Stop Drilling Her No Matter How Many Times She Cums

  • censoredsquirtingslutNHDTBnatural highremonha to nakashimaNHDTB-525NHDTB5251nhdtb00525
    • 2021-05-07
    168 min

    [IPX-660]If You Don't Want To Get Into Trouble, Then Take Off Your Panties. Dirty Shoplifting Gals ... The Tragedy Of Relentless Piston-Pounding Pussy Pumping That Won't Ever Stop, No Matter How Many Times He Cums, And He Won't Ever Let H

  • kana momonogi censoredblowjobbeautiful girlIPXidea pocketkyoseidishIPX-660IPX660ipx00660
    • 2021-05-21
    61 min

    491TKWA-172 The model goddess body, Enko J ●, is fucked and vaginal cum shot is made for 2 consecutive times!

  • amateur censoredcreampiebig titstkwatkwa-172tkwa172491tkwa-172
    • 2021-05-24
    68 min

    498DDH-017 [Deliher Voyeur] Immediate scale & best tongue tech that licks the whole body from toes to anal! Miss Dirty Little Deli and Lipi SEX with Ji ● Po dripping love juice in front of you!

  • amateur censoredcreampiebig titsddhddh-017ddh017498ddh-017
    • 2021-06-10
    64 min

    515BTGL-007 Hina (22)

  • amateur censoredanalcreampiebtglbtgl-007btgl007515btgl-007
    • 2021-06-15
    135 min

    [SDJS-119]As A Reward For Working So Hard This Past Year, We Decided To Reward Her With Some Company Benefits, And Gave Her A Coupon For A Super High Class Massage Parlor! This SOD Employee Is In Her Second Year At The Company, And Now She's Hook

  • kotoba nakayama censoredsingle workSDJSsod createchinpo dazaisod starSDJS-119SDJS1191sdjs00119
    • 2021-06-19
    177 min

    [CJOD-302]Slut Duo In Masks - Rock Hard Between Their Massive Mammaries, Pinned By Their Voluptuous Bodies, Made To Creampie Both Of Their Pussies

  • censoredcreampiebig titsCJODchijo heavensandmanCJOD-302CJOD302cjod00302
    • 2021-06-26
    148 min

    [HUSR-237]I Love Male Body Fluids!! This Real Beauty Is Slutty And Perverted! Sweaty Sex With A Celebrity-Grade Beauty!

  • roxy rocket tear blonde censoredbig titsamateurHUSRbig morkalbooker thussleHUSR-237HUSR23757husr00237
    • 2021-07-19
    76 min

    FC2PPV 1930903 [9980 → First Time Limited 2980] First Shot ❤️ Cute Child Who Came To Tokyo At The Time Of Admission ❤️ Complete Appearance Of A Miracle By Squeezing The Power Of Adults ❤️ Cum Shot With The Second Cock In Life ❤️ Naka Is Useless ̷

  • amateur uncensoredfc2
    • 2021-07-30
    42 min

    328HMDN-387 [Cuckold 3P] Face Strongest Shaved Beauty Big Tits Ol Harun Continuous Pistons To Compete For The Tsuruman Of A Nasty De S Beauty Who Plays With Two Cocks! Sweaty Sex Skewering A Sensitive Body With Two People

  • amateur censoredamateurhmdnhmdn-387hmdn387328hmdn-387
    • 2021-07-30
    40 min

    359TYVM-177 Incest I Dreamed Of … The Year’S Different Seeding Sex That Fulfills The Desire Of A Fifty Wife That My Son Wanted!

  • amateur censoredcreampiemarried womantyvmtyvm-177tyvm177359tyvm-177
    • 2021-08-12
    240 min

    [SW-791]"Put A Huge Cock In Me With My BF By My Side!" Unable To Fuck Her Hospitalized BF, These Girls Seduce A Patient In The Same Room With A Panty Shot And Take Their Erect Cocks From Across The Curtain, 15 Girls 240 Minutes Special!!

  • censoredblowjobSWswitchyocchanswitch switchSW-791SW7911sw00791
    • 2021-08-20
    148 min

    [JUL-692]Young Employees With No Manners Turn Married Teacher Into A Slut. Business Manner Training G*******g. Maki Tomoda

  • maki tomoda censoredcreampiemature womanJULmadonnaunicorn fukudaJUL-692JUL692jul00692
    • 2021-08-21
    69 min

    SIRO-4619 [First Shot] [Healing Boobs To Be Admired] [Obscene Body Of A Neat Nursery Teacher] A Fascinating G Milk Nursery Teacher Who Is Sure To Be Very Popular With Both Children And Adults. A Neat And Clean Beauty Disturbs Marshmallow Beautiful Br

  • amateur censoredbig titsamateursirosiro-4619siro4619siro-4619
    • 2021-09-02
    32 min

    FC2PPV 2129074 [New Work, Half Price! ] ♀ 324 Female College Student Ri ◯ -Chan 20 Years Old 1st Time A Tall Slender Beauty Makes Her Av Debut With A Genuine Vaginal Cum Shot Prepared For Pregnancy With A Complete Appearance That Is Open To The World

  • amateur uncensoredfc2
    • 2021-10-14
    61 min

    299EWDX-386 Massive Squirting Acme! Unauthorized Vaginal Cum Shot To A Super Sexy Beauty Witch

  • amateur censoredcreampiemarried womanewdxewdx-386ewdx386299ewdx-386
    • 2021-10-15
    123 min

    [FOCS-029]Picking Up Girls To Meet An SSR Tier Ultra Cute Gal That Wants To Be A Total Fuck Buddy! Face Off To See Who Gets To Fuck! Record Of This Slutty Girl"s Amazingly Hot Sex! Yuna Himekawa

  • yuuna himekawa ran tsukishiro censoredslutsingle workFOCSabc mousou zokufocusFOCS-029FOCS029focs00029
    • 2021-10-15
    230 min

    [KRU-132]Shooting At The Market Somewhere In The City. Amateur Girls For Down-blouse Shots And Panty Shot Peeping Footage.

  • censoredbig titslingerieKRUkarmagroupKRU-132KRU132kru00132
    • 2021-11-03
    56 min

    416SVMM-056 Mizuki (Natural Mizuki)

  • amateur censoredcreampiesquirtingsvmmsvmm-056svmm056416svmm-056
    • 2021-11-26
    278 min

    [360MBMS-023]素人ホイホイ×MBM このルックスに、この爆乳！！神が与えた奇跡 1000人に1人の逸材 爆乳素人 4 撮り下ろし3名

  • amateur censoredbig titsamateurmbmsmbms-023mbms023360mbms-023
    • 2021-12-02
    17 min

    [HEYZO-2666]Sakura Kazuki A Titty Fuck with Sakura

  • sakura kazuki uncensoredheyzo
    • 2021-12-03
    110 min

    ERK-014 Yume-Chan (Yume Kotoishi)

  • amateur censoredamateurcosplayerkerk-014erk014erk-014
    • 2021-12-05
    240 min

    [BUR-582]Step-uncle Involves His Step-niece In Lewd Pranks When She Visits Home - Caught On Camera. 4 Hours.

  • censoredcreampieuniformBURglayzburst gureizuBUR-582BUR58212bur00582
    • 2021-12-08
    48 min

    229SCUTE-1141 Sena (23) S-Cute Sex (Sena Kasumi) Who Devours The Naked Body Of A Busty Beauty

  • amateur censoredbig titsamateurscutescute-1141scute1141229scute-1141
    • 2021-12-31
    86 min

    529STCV-050 Cuckold Cuckold Cuckold Wife! The Celebrity Wife Who Lives In The 6LLDDKK Mansion Is A Former Bridal Planner Of The Groom Killer! If The House Is Big, The Milk Is Big! "Sex Like This For The First Time In A While …" Planning

  • amateur censoredcreampiebig titsstcvstcv-050stcv050529stcv-050
    • 2022-01-07
    118 min

    [DASD-958][Against her Better Judgment] Aphrodisiacs from her Loathed Ex-Boyfriend Lead to Her Body Quaking in Pleasure and Her Skin Covered with Cum. Wild Sex Full of Ecstasy. Yu Shinoda

  • shinoda yu censoredcreampiebig titsDASDdasrokusaburo mishimaDASD-958DASD958dasd00958
    • 2022-01-09
    80 min

    230OREC-989 Minami (Minami Hironaka)

  • amateur censoredcreampieamateurorecorec-989orec989230orec-989
    • 2022-01-13
    53 min

    H4610 ki220113 Emi Hasegawa 21years old

  • amateur uncensoredh4610
    • 2022-01-22
    124 min

    [AGAV-071]I"m A Dirty Perverted Old Man... And This Girl Gets Fucked By Me - Renai Amane

  • amane romance censoredcreampiedeepthroatAGAVsex agent daydreamersusubashisuisex agentAGAV-071AGAV071agav00071
    • 2022-02-05
    134 min

    [APAK-216]Girl Working Part-time Has Amazing Jiggling F-cup Tits Underneath Her Uniform, She Gets Fucked Deep In Her Pussy For Intense Pleasure By Her Lustful Manager Who Has Huge Dick. Non Ohana

  • florets censoredcreampiebig titsAPAKaurora project annexrkaurora project anexAPAK-216APAK216apak00216
    • 2022-02-11
    149 min

    [MEYD-738]10,000 Social Media Followers! Hookup Over The Internet! You Can Meet Her Immediately If You Book A Reservation! There"s Nothing She Won"t Do And She"s A Cum Swallowing Angel! A Currently Active Yoshiwara Soapland Princess Makes

  • censoredsquirtingblowjobMEYDtameike gorotake dMEYD-738MEYD738meyd00738
    • 2022-02-16
    59 min

    230OREC-1025 Rena-San & Takuma-Kun (Rena Kodama)

  • amateur censoredamateurbeautiful girlorecorec-1025orec1025230orec-1025



    • Japan xxx, japanese adult videos, japani sexy, Japanese Adult Movies, JAV censored, Japanese tube, Japanese sex online