jav amateur creampie javcensored hours more




FC2NACRHNDCHRVIPXMIAAAPODNACXGMEMAUKGMIDVJUFEVEMAFSDSSMEYDSPRDHDKAATIDAVSADASDKSBJ

2020-10-25
129 min

[ONSG-028]Big Tits Derriere, Ryo Arimori

  • ryo arimori miyu tokohara censoredcreampiebig titsONSGgain corporationONSG-028ONSG028onsg00028
    • 2020-11-06
    14 min

    10musume 110620_01 Love Juice Splash! Look at An Amateur’s Dildo Masturbation Kaori Ota

  • amateur uncensored10musume
    • 2020-11-12
    118 min

    [FSDSS-121]Nene Yoshitaka's Lively NTR Home Visit

  • nine yoshitaka censoredamateursingle workFSDSSfalenoponyfaleno starFSDSS-121FSDSS1211fsdss00121
    • 2020-12-02
    54 min

    345SIMM-565 Hebereke new graduate OL seduces boss! Drinking at home creates a nice atmosphere → Demonstrate the true character of carnivorous girls!

  • amateur censoredcreampieamateursimmsimm-565simm565345simm-565
    • 2020-12-07
    94 min

    300MIUM-655 Cheating addictive hypersexual wife! !! !! → [Abnormal sexual desire floats so much that if there is a type, it will be reversed! !! !! ] × [Anyway, “Beauty” & National Treasure-class beauty big breasts & bicubic convuls

  • amateur censoredcreampiesquirtingmiummium-655mium655300mium-655
    • 2020-12-10
    50 min

    [MIHA-051]It's A Danger Day Fuck Fest!! You Get To Make Babies At This Soapland 25 Mr. Michiru 5th Year Anniversary Exclusive Actress Audition Judging The Acting Category Riko Sato

  • riko sato censoredcreampiebig titsMIHAmr michirusaitaMIHA-051MIHA0511miha00051
    • 2020-12-20
    136 min

    [JUL-412]I Had To Leave My Lecherous Old Man And My Weak-Willed Wife For A 2-Night, 3-Day Business Trip. Sure Hope Nothing Happened... Natsu Tojo

  • natsu tojo censoredmature womansingle workJULmadonnamametaro mamezawaJUL-412JUL412jul00412
    • 2020-12-21
    56 min

    10musume 122120_01 Preparedness of Pregnancy Creampie With Santa Cosplay Hitomi Ikeda

  • amateur uncensored10musume
    • 2020-12-26
    123 min

    [MIAA-370]In Our Dorm, Across From My Room, Lives My Favorite Big Tits Female Teacher I Was Secretly Enjoying Myself, Peeping On Her, But Ever Since That Day, When She Caught Me... She Began To Escalate The Titty Temptation And When I Could No Longer

  • tsujii honoka censoredcreampiebig titsMIAAmoodyzhiroyuki kimuraeveryone s porn starMIAA-370MIAA370miaa00370
    • 2020-12-27
    125 min

    [KNAM-030]All Raw STYLE @ Mona # Bratty Young Slut # Her Panties Are Soaked # Her First Compensated Date # Powerful Pussy # Completely Raw Fuck # Buckets Of Cum Mona Amemiya

  • amemiya mona censoredcreampieblowjobKNAMfirst star100 raw styleKNAM-030KNAM030h-491knam00030
    • 2021-01-01
    135 min

    [URKK-035]10 Orgasms Minimum!! Big Tits Magic Massage Salon Where You Can Cum Inside Her As Many Times As You Want While Her Big Tits Shake As She Has Orgasm After Orgasm - Hikari Sena

  • hikari sena censoredcreampiebig titsURKKunfinishedwild sevenone milk of soulURKK-035URKK035urkk00035
    • 2021-01-01
    482 min

    [DRC-022]Picking Up Girls Undercover At A Swingers' Party - 8 Hours

  • censoredcreampiebig titsDRCprestigedocument recordDRC-022DRC022118drc00022
    • 2021-01-12
    87 min

    300NTK-500 An AV actor has a beautiful ass stalker! ？？ The distorted love of a beautiful girl is extremely decided to appear safely! !! Convulsions Momojiri by inserting raw chin of delight! !! Pure love SEX of a greedy beautiful girl who requests a

  • amateur censoredcreampieamateurntkntk-500ntk500300ntk-500
    • 2021-01-20
    62 min

    SIRO-4393 [First shot] [Face staring at you] [Naughty voice that doesn’t stop] Popular at the stadium! A beautiful girl beer seller sighs and serves a big cock. She keeps screaming her pleasure .. AV application on the net → AV experience shooti

  • amateur censoredamateursirosiro-4393siro4393siro-4393
    • 2021-01-28
    72 min

    [SIIN-022]純真無垢 関谷セリナ

  • sekiya serina censoredbig titssingle workSIINsidSIIN-022SIIN022h-816siin00022
    • 2021-01-28
    45 min

    C0930 ki210128 Mayumi Ono 30years old

  • amateur uncensoredc0930
    • 2021-01-29
    240 min

    [NASH-448]Adultery - Unsatisfied Married Woman`s Adulterous Heart -

  • censoredcreampiemature womanNASHnadeshikoNASH-448NASH448h-067nash00448
    • 2021-02-03
    136 min

    [GVH-185]Sexy PTA President & Seductive Female Teacher Encounter A Naughty S*****t Council President Ayaka Muto / Hitomi Katase

  • ayaka muto hitomi katase censoredmature womanGVHglory questhyonGVH-185GVH18513gvh00185
    • 2021-02-05
    65 min

    FC2PPV 1673698 [S-class] Refre beauty miracle re-appearance ❤️❤️ Cool expression changes completely! I screamed with a hard cock & blushed ❤️❤️

  • amateur uncensoredfc2
    • 2021-02-12
    81 min

    383REIW-046 An

  • amateur censoredcreampieamateurreiwreiw-046reiw046383reiw-046
    • 2021-02-21

    FC2PPV 1696163 Limited number [Uncensored] Helping JD’s dream of innocent animal lovers ・ Continuous vaginal cum shot

  • amateur uncensoredfc2
    • 2021-02-27
    241 min

    [ITSR-089]A Serious Old Lady "Don't Tease Me" At First She Was Laughing, But Now The Mood Is Turning Toward Real Fucking!？ In The End, Is This Old Lady Serious About Creampie Fucking!？ 4-Hour Best Hits Collection

  • censoredcreampiemature womanITSRbig morkalmaxitadakiITSR-089ITSR08957itsr00089
    • 2021-03-12
    59 min

    FC2PPV 1717012 [No x facial] A large amount of sperm is shot on a beautiful face … (NO.006 Naughty-chan / Second half) "Personal shooting / Gonzo"

  • amateur uncensoredfc2
    • 2021-03-14
    16 min

    10musume 031421_01 Secret Pussy Collection: Yuko Ikeda

  • amateur uncensored10musume
    • 2021-03-17
    49 min

    FC2PPV 1730047 Meychan’s latest work! !! I won’t lose to my sister! I tried to reverse Nan, but tears. Tears. Creampie etch from! !!

  • amateur uncensoredfc2
    • 2021-03-21
    154 min

    [CAWD-186]Super Close Up Coquettish Camera Angles Observing Every Inch Of Her Perfect Body Mayuki Ito

  • maiyuki ito censoredcreampiebig titsCAWDkawaiihirokoji osakiCAWD-186CAWD186cawd00186
    • 2021-03-25
    61 min

    Pacopacomama 032521_451 The Training For Wife: Kimono Beauty In Acrobatic Hardcore Kana Miura

  • amateur uncensoredpacopacomama
    • 2021-04-08
    122 min

    [FSDSS-203]Cumming For The First Time! 4 Orgasms Super Beautiful Girl All Sex Special Momo Honda

  • honda peach censoredsquirtingblowjobFSDSSfalenomusetafaleno starFSDSS-203FSDSS2031fsdss00203
    • 2021-04-09
    274 min

    [MDTM-717]Creampie Raw Footage Of A Loose But Highly Educated College Girl Who Is Hunting For Sugar Daddies To Fulfill Her Lust 3

  • censoredcreampiebig titsMDTMuchu kikakutetMDTM-717MDTM717mdtm00717
    • 2021-04-17
    120 min

    [JUL-540]Rare Gem - Mrs Diamond Exclusives Part 4! Her First Adultery! "I'm Off To My Class Reunion," She Says, And Three Hours Later She's Already Fucked. Hitomi Honda

  • honda hitomi censoredmature womansingle workJULmadonnaJUL-540JUL540jul00540
    • 2021-04-28
    55 min

    517MQXT-010 Enema Climax Daughter Who Explodes To The extent That It Goes Mad

  • amateur censoredanalamateurmqxtmqxt-010mqxt010517mqxt-010
    • 2021-04-28
    200 min

    [GODR-1017]Full On Step Family Love Step Mother And Step Son Have Sex

  • censoredamateurGODRvipgodGODR-1017GODR101778godr01017
    • 2021-05-07
    237 min

    [MUCD-247]Akari Mitani 4 Hours Super Best Of Collection To Enjoy "Akarin" For 240 Whole Minutes Permanent Download Version

  • mitani akari censoredcreampiecosplayMUCDmukuMUCD-247MUCD247mucd00247
    • 2021-05-14
    252 min

    [360MBMS-004]素人ホイホイ×MBM 可愛すぎて死ぬ・・・ 天使降臨 2 撮り下ろし3名

  • amateur censoredamateurbeautiful girlmbmsmbms-004mbms004360mbms-004
    • 2021-05-15
    120 min

    [AQSH-069]This NEET Married Woman Wanted To Become An Amateur Magazine Model So When This Guy Said He Was A Producer Who Could Hook Her Up She Took The Bait And He Made Her Go Through A Filthy And Sexually Demoralizing Experience

  • yoko yamaguchi censoredcreampiemature womanAQSHaquamall heroaquamallAQSH-069AQSH069aqsh00069
    • 2021-05-16
    70 min

    413INST-122 [Major company model] Leaked ● Hard raw SEX at a secret cosplay photo session A narrow pussy is opened with a thick cock and acme died in a few minutes ● ● Seeding (leaked Gonzo data)

  • amateur censoredcreampiebig titsinstinst-122inst122413inst-122
    • 2021-05-22
    124 min

    [MGMQ-073]My Colleague's Flashy OL Gal Is A High Grade Masochistic Nympho Who Works As A High-class Anal Prostitute - Kurumi Shiiki

  • shiiki walnut censoredanalslutMGMQmegamithe beautiful goddess queenMGMQ-073MGMQ073mgmq00073
    • 2021-06-16
    80 min

    259LUXU-1423 Luxury TV 1418 A nursery teacher who smiles with a desire to like intense sex has appeared! When blamed for an unusually embarrassing appearance, he dyes his cheeks and is embarrassed, but gradually becomes open with a violent piston and

  • amateur censoredamateurluxuluxu-1423luxu1423259luxu-1423
    • 2021-06-16
    64 min

    444KING-037 Reirei

  • amateur censoredcreampiesquirtingkingking-037king037444king-037
    • 2021-06-19
    240 min

    [CJOB-090]Bondage Play With A Sadistic Beauty - I Can't Move, And She Makes Me Cum Again And Again! BEST

  • emi fukada hasumi claire censoredslutCJOBslut havenslut haven bestCJOB-090CJOB090cjob00090
    • 2021-06-26
    74 min

    [XVSR-602]Masked Couples - Deceiving Women And Deceived Women - Chapter 2 Hibiki Otsuki

  • otsuki sound censoredcreampiedramaXVSRmax ak c takedacalenXVSR-602XVSR602xvsr00602
    • 2021-07-02
    118 min

    [SHKD-954]Fiance Targeted By A Man With Scissors Who Fucks Her and Tears Her Clothes - Yuri Sasahara

  • yuri sasahara censoredsingle workSHKDattackerskazumashi yoru akuSHKD-954SHKD954shkd00954
    • 2021-07-08
    276 min

    [PIYO-121]An Amazing Masochistic Beauty Who Gets Wet From Deep Throating...A Lovey Dovey Throat Fuck Smiling During Sex And Swallowing Semen

  • yokomiya nanami maika hizumi censoredsquirtingdeepthroatPIYOhiyokopiero taPIYO-121PIYO1211piyo00121
    • 2021-07-12
    75 min

    FC2PPV 1894485 [individual] Real Aunt 55 Years Old And Sexual Intercourse. A Mature Woman Who Is Estrus To A Man She Knows Since She Was Little And Is Cum Shot By Herself Taken And Released [first Special Price]

  • amateur uncensoredfc2
    • 2021-07-20
    99 min

    [OFKU-186]How Do I Convince The Horny Beautiful Wife In A Tight Miniskirt Who Lives In The Same Apartment Complex As Me To Fuck？! Naho Yozora 41 Years Old

  • naho yozora censoredcreampiebig titsOFKUstar paradisemom railOFKU-186OFKU186h-254ofku00186
    • 2021-07-22
    120 min

    [FSDSS-250]Hey, Shiina! A Revenge Orgasmic Documentary By Actors, Directors, And Managers Who Have All Been Treated Like Garbage By Sora Shiina!!

  • shiina sky censoredblowjobbeautiful girlFSDSSfalenomanyufaleno starFSDSS-250FSDSS2501fsdss00250
    • 2021-07-24
    46 min

    [H4610-ori1761]赤堀 莉佳子 20歳

  • amateur uncensoredh4610
    • 2021-07-28
    420 min

    345LVSIMM-003 [Limited Time Sale] [Mgs Exclusive Distribution Best] God Paco Shiroto 20 People Shiroto Manman Best 7 Hours Vol.03

  • amateur censoredcreampieamateurlvsimmlvsimm-003lvsimm003345lvsimm-003
    • 2021-08-05
    44 min

    FC2PPV 1954736 (Appearance Of The Main Story) Amateur M-Chan Breeding Record Reward Meat Stick White Eyes Dying Edition "Ah" Ah …! Muzzle Gimojii "Ii … !! ///" Glinglin ♂ So Much That The Uterus Turns Over … Bonus Ant

  • amateur uncensoredfc2
    • 2021-08-09
    56 min

    FC2PPV 1976754 Celebrities Like Raw ♡] Beautiful Breasts Nice Ass Perfect Body Natural Cosmetics Brand Female President Wife Gan Butt Fuck Ass Pururun Gachi Acme Organic Sperm Seeding Creampie Fxxk

  • amateur uncensoredfc2
    • 2021-08-13
    75 min

    374IMGN-019 Noai

  • amateur censoredcreampiebig titsimgnimgn-019imgn019374imgn-019
    • 2021-09-25
    151 min

    [APKH-187]Big Tits Girl In School Uniform Encourages Step-brother To Fuck Her In A Love Hotel Sakura Tsuji

  • sakura tsuji censoredcreampiebig titsAPKHaurora project annexhAPKH-187APKH187apkh00187
    • 2021-09-28
    61 min

    HEYZO 2620 Toying With Sweaty Hot Chick! Vol.3 – Momoka Ogawa

  • momoka ogawa uncensoredcreampiehandjobheyzo
    • 2021-10-05
    88 min

    261ARA-509 [Cute Girl] [Seriously Beautiful] Mana-Chan Is Here! The University Is In A State Of Withdrawal Online … I Want To Get Rid Of It Since I Wanted To Meet People! !! Transcendental Cutie With Full-Blown Etch Aura ♪ [Transcendent Slender]

  • amateur censoredamateuraraara-509ara509261ara-509
    • 2021-10-21
    123 min

    [FSDSS-301]Really Close-Up and Sexy Angles of Sexual Negotiations, Minamo Nagase

  • minase nagase censoredbig titsFSDSSfalenoskyscraperfaleno starFSDSS-301FSDSS3011fsdss00301
    • 2021-10-29
    162 min

    [MIAA-521]The Absolute Aerial Domain She"ll Jam Your Cock Into Her Silky Smooth Cunt Crack And Between Her Thighs And Toy With You Because She"s A Devilish Barely Legal Babe Ichika Matsumoto

  • ichika matsumoto censoreduniformslutMIAAmoodyzmasaki naominna no kikatanMIAA-521MIAA521miaa00521



    • Japan xxx, japanese adult videos, japani sexy, Japanese Adult Movies, JAV censored, Japanese tube, Japanese sex online