high vision javcensored planning censored slut




FC2MILKNACXHODVNNPJHDKACHRVAWDVEMADTTADNNACRSPRDSANSSNIJULEBODSDABCJODWANZIPX

2021-01-08
136 min

[HODV-21542][Complete POV] Girl Speaking The Ibaraki Dialect - Naoko Akase

  • naoko akase censoredcreampiesingle workHODVh m pHODV-21542HODV215425642hodv21542
    • 2021-01-16
    21 min

    H4610 ki210116 piddle

  • amateur uncensoredh4610
    • 2021-01-27
    169 min

    [MDVHJ-028]"I Can't Tell You" That I Got Fucked By My Father-In-Law...

  • erika pure white censoredcreampiebig titsMDVHJgraffiti japanmovieMDVHJ-028MDVHJ02848mdvhj00028
    • 2021-01-31
    99 min

    [VEC-464]I Took A Hot Married Woman Home From Her Part-Time Job For Creampie Sex Honoka Tsujii

  • tsujii honoka censoredcreampiebig titsVECvenusbingo tamatsukamegami venusVEC-464VEC464vec00464
    • 2021-02-02
    60 min

    H0930 ki210202 Miki Taniguchi 45years old

  • amateur uncensoredh0930
    • 2021-02-05
    68 min

    [YMDS-016]First Time Amateur Shots Documental: Can't Let An Amateur Of The Highest Class Get Away (Rina, 21)

  • censoredcreampieamateurYMDSmomotaro video publishingasakusa is jiroyoung peachYMDS-016YMDS016ymds00016
    • 2021-02-06
    118 min

    [ADN-290]Licking Hard: Father In Law's Desire 7 - Shihori Kotoi

  • shiori kotoi censoredsingle workdramaADNattackersnaotootona no dramaADN-290ADN290adn00290
    • 2021-02-19
    245 min

    [TUS-093]120 Real Legend Of Picking Up Girls Vol. 93: Exploring The Tokai Region On A Pilgrimage Of Crotches! 245 Minutes Of Rich Hauls!

  • censoredcreampiebig titsTUSprestigetsuri shiTUS-093TUS093118tus00093
    • 2021-02-21
    137 min

    [HND-949]This Devilish New Employee Is Tempting Me Directly With Super Close-Up Sexual Action! She Seems To Be A Natural Airhead, But It's All An Act, Because Then She Starts Holding Me Tight And Whispering Dirty Talk Into My Ear And Luring Me To

  • natural kanon censoredcreampiebeautiful girlHNDhon nakamametaro mamezawaHND-949HND949hnd00949
    • 2021-02-24
    48 min

    [CSDX-006](4K) Cosplay + Aoi Kururugi 3 Aoi Kururugi

  • aoi kururugi censoredblowjobcosplayCSDXcosdeluxeCSDX-006CSDX006h-1558csdx00006
    • 2021-03-06
    47 min

    FC2PPV 1714707 [1000 until 3/20] 150cm OL Umi-chan, 22 years old Saffle is 1H a month, so I’m frustrated and apply for Gonzo

  • amateur uncensoredfc2
    • 2021-03-12
    76 min

    [DORI-013]Sex Film No. 13 There's Nothing Better Than A Pale Plump Big Titty H-Cup S********l With Just A Hint Of Innocence Who Still Blushes When Being Carressed And Kissed!

  • censoredcreampieschoolgirlDORIfirst starsucking shootingDORI-013DORI013h-491dori00013
    • 2021-03-13
    134 min

    [CESD-985]Girls Making Girls Cum! Rena Aoi's Lesbian SEX

  • blue yui hatano censoredlesbianmature womanCESDceleb no tomoCESD-985CESD985cesd00985
    • 2021-03-23
    93 min

    FC2PPV 1738386 Big Chris Slender beauty busty girl finished violently with Lady Gras ♥ ️ ♥ ️ [Personal shooting]

  • amateur uncensoredfc2
    • 2021-03-27
    50 min

    Pacopacomama 032721_452 Maternity Immoral SEX Nanako Asahina

  • amateur uncensoredpacopacomama
    • 2021-04-02
    130 min

    [SHKD-938]While This Baseball Player Who Had Been Recently Cut From The Team Was Being Interviewed For A Story, His Devoted Wife Was Getting Anal Fucked Reiko Kobayakawa

  • kobayakawa reiko censoredsingle workSHKDattackerstkuo otanisharkSHKD-938SHKD938shkd00938
    • 2021-04-06
    126 min

    [SDDE-646]Anal Brainwashing Anal Training With A Five Day Intestinal Cleansing Diet That Rejuvenates Both The Body And Soul Akari Niimura

  • akari shinmura censoredanalcreampieSDDEsod createichigoharasenzSDDE-646SDDE6461sdde00646
    • 2021-04-14
    234 min

    [HUNTA-988]"My Body Isn't Enough Thanks For You？ I'm Not Just A K*d, You Know..." Runaway S********l Takes Over My Room, But She's So Cute That I Don't Really Mind...

  • censoredcreampieschoolgirlHUNTAhuntercognac kaminohhh groupHUNTA-988HUNTA988hunta00988
    • 2021-04-15
    114 min

    [VENX-026]One Night And Two Days Of Being Drained Dry By My Wife's Older Sister Who Suddenly Came On To Me

  • narita tsumugi censoredcreampiemature womanVENXvenuskaniefakecest winntersVENX-026VENX026venx00026
    • 2021-04-16
    555 min

    [LXV-039]【期間限定販売】【MGSだけのおまけ映像付き 75分】ラグジュTV×PRESTIGE PREMIUM 37 オトナのエロさここに極まる！美女達の本当の姿を余すところなく全部見せます！！

  • amateuramateur censoredbig titsmarried womanlxvlxv-039lxv039lxv-039
    • 2021-04-17
    176 min

    [JUL-538]She's So Beautiful You Can Barely Look At Her. An Komatsu, Age 30, Porn Debut - Exudes Mysterious Sensuality "Listless Type" Fresh Face Star.

  • anzu komatsu censoredmature womansingle workJULmadonnamametaro mamezawaJUL-538JUL538jul00538
    • 2021-04-23
    120 min

    [MIAA-425]Convulsion Pleasure With Sexy Oil Aggressively Licking Her Pussy After She Already Came AIKA

  • aika censoredbig titssquirtingMIAAmoodyztrendy yamaguchieveryone s porn starMIAA-425MIAA425miaa00425
    • 2021-04-24
    147 min

    [LULU-069]Your Step-Aunt Used To Be A Slut, And Now She Still Wants To Ride Her Nephew's Massive Cock For A Quickie, Booty Bouncing For Cowgirl Sex To Wring Out 18 Loads. Ayane Sezaki

  • ayane sezaki censoredcreampiesingle workLULUlunaticsluminaxLULU-069LULU069lulu00069
    • 2021-05-01
    69 min

    383REIW-058 Sarina

  • amateur censoredcreampiebig titsreiwreiw-058reiw058383reiw-058
    • 2021-05-10
    61 min

    Caribbeancom 051021-001 Very First Anal Sex With Anger Reika Kudo

  • reika kudo uncensoredanalcreampiecaribbeancom
    • 2021-05-10
    96 min

    374IMGN-012 Mie (26)

  • amateur censoredcreampieamateurimgnimgn-012imgn012374imgn-012
    • 2021-05-11
    64 min

    Caribbeancom 051121-001 Sex practice with my sister-in-law who wants to work in luxury spa Rino Sakuragi

  • rino sakuragi uncensoredcreampiecaribbeancom
    • 2021-05-19
    50 min

    [051921-001][VR] Sex with nurse cosplay

  • emiri momota uncensoredcreampiecaribbeancom
    • 2021-06-03
    485 min

    [AKDL-116]9 Fucks Involving Barely Legal Babes Who Love Older Men And Will Get Their Slut On While Smiling And Getting Them Erect Even If Their Wives Are Nearby

  • sana moribo yoko kokoro censoredbig titsbeautiful girlAKDLaquinoriaquinoriaknrAKDL-116AKDL1161akdl00116
    • 2021-06-12
    62 min

    1Pondo 061221_001 Naughty Kiss And Fucking: Riri Shiraki

  • amateur uncensored1pondo
    • 2021-06-22
    136 min

    [STARS-415]"Want to Have the Most Erotic Kiss in the Whole World？" The Lips That Forget All Reason and Lick Over and Over, the Never-Ending Kiss. Mana Sakura [Jack off to overwhelming 4K resolution!]

  • mana sakura censoredblowjobhandjobSTARSsod createoffice uenishiSTARS-415STARS4151stars00415
    • 2021-07-02
    68 min

    230OREC-812 Rina

  • amateur censoredcreampieamateurorecorec-812orec812230orec-812
    • 2021-07-08
    93 min

    [OKK-028]Sakura Tsuji: Goddess In A Wet, Shiny, And Tight High-Performance Swimsuit! Enjoy This Cute Lolita-Faced Girl In Her High-Performance Swimsuit To Your Heart's Content! We Start By Watching Her Change In A Voyeur Video. In This Fetish Fil

  • sakura tsuji censoredbeautiful girlsingle workOKKoyaji no kosatsukamikyoueiOKK-028OKK0281okk00028
    • 2021-07-09
    147 min

    [MIFD-167]Debut of New 19 Year Old Open and Erotic Beauty With G-cup Tits, Who Grew Up in a Nudist Family Where No Bra, No Underwear Full Nudity Was Allowed!! Haruka Kishii

  • haruka kishii censoredbig titsbeautiful girlMIFDmoodyzusapyonmoodyz freshMIFD-167MIFD167mifd00167
    • 2021-07-15
    120 min

    [DDHZ-011]A Woman Addicted to Confinement: The Sexually Frigid Biracial Blonde Wife. Karina Nishida.

  • nishida karina censoredbdsmsingle workDDHZdogmanormal kimmy wifeDDHZ-011DDHZ011ddhz00011
    • 2021-07-22
    124 min

    [NHDTB-558]I Met This Slut At The Men's Bath 5 She Suddenly Gave Me A French Kiss And Held Me Tight And Fucked Me And I Could No Longer Resist, So I Came Inside Her Pussy, Over And Over Again

  • censoredcreampiebig titsNHDTBnatural highbacon tanakaNHDTB-558NHDTB5581nhdtb00558
    • 2021-07-24
    71 min

    SIRO-4602 [First Shot] [SSS Class Super Sensitive Body] [Endless Squirting] A Talented Material That Combines The Best Sensitivity With The Best Body Has Appeared. While Fascinating A Technique That Does Not Seem To Be 21 Years Old, She Happily Licks

  • amateur censoredsquirtingamateursirosiro-4602siro4602siro-4602
    • 2021-09-11
    242 min

    [UMSO-413]What Would Happen If You Masturbated In Front Of A Colossal Tits Massage Therapist!？ Highlights 13 Ladies

  • mizuna wakatsuki ama dro censoredbig titsUMSOkm produceumanamiUMSO-413UMSO413umso00413
    • 2021-09-19
    56 min

    FC2PPV 2222096 * Limited To 2 Days 2980⇒1980 ★ Soft F-Cup Huge Breasts Cabaret Girl Who Cuts 1000 People ♥ Mari-Chan 20 Years Old ☆ Sensitive Pussy Is Immediate ♥ Endurance Limit To Rich Blowjob ♥ Inserted Raw Into A Beautiful Man! Creampie Fertiliza

  • amateur uncensoredfc2
    • 2021-09-22
    60 min

    438PVMB-015 Yui (Usui Ren)

  • amateur censoredcreampieamateurpvmbpvmb-015pvmb015438pvmb-015
    • 2021-09-23
    159 min

    [IENF-166]Naive Girl From A Private Girls" School Is Ready To Try!？ One Sheet Of Plastic Wrap Is All That Separates Her From Trying Her Guy Friend"s Dick!

  • miu ito yumi kikuchi censoredcreampieschoolgirlIENFie nergyienfIENF-166IENF1661ienf00166
    • 2021-09-24
    120 min

    [SSIS-183]During The Boss"s Absence Due To A Business Trip, I Fucked His Wife Like Crazy For Three Days. Aika Yumeno

  • yumeno aika censoredbig titssingle workSSISs1 no 1 stylemonSSIS-183SSIS183ssis00183
    • 2021-09-28
    62 min

    Pacopacomama 092821_538 Wives Drink Cum 120 Yae Takayama

  • amateur uncensoredpacopacomama
    • 2021-10-07
    80 min

    [REBD-592]Rikka Manatsu"s Snowflakes Rikka Ono

  • rokka ono censoredsingle workREBDrebeccasawamura akiraREBD-592REBD592h-346rebd00592
    • 2021-10-27
    53 min

    [ETQR-303][Daydream POV] Raw Sex With Beautiful Girl In Sailor Uniform. Yukino

  • censoredcreampieuniformETQRerotic timeETQR-303ETQR303etqr00303
    • 2021-10-29
    162 min

    [MIAA-521]The Absolute Aerial Domain She"ll Jam Your Cock Into Her Silky Smooth Cunt Crack And Between Her Thighs And Toy With You Because She"s A Devilish Barely Legal Babe Ichika Matsumoto

  • ichika matsumoto censoreduniformslutMIAAmoodyzmasaki naominna no kikatanMIAA-521MIAA521miaa00521
    • 2021-10-29
    108 min

    [ADN-355]I Have Sex With My Father-in-Law... Minami Shiratori

  • minami shiratori censoredsingle workdramaADNattackerstakasugi ryouotona no dramaADN-355ADN355adn00355
    • 2021-11-09
    59 min

    10musume 110921_01 I Made A Vaginal Cum Shot With A Naughty Girl I Met On SNS Masami Ikenaga

  • amateur uncensored10musume
    • 2021-11-12
    86 min

    535LOG-004 [Personal Shooting] Loose Fluffy Girlfriend With Cute Chubby Lips! !! The Crotch Gets Hot With Plenty Of Ass And Beautiful Legs That You Want To Lick! It Was A Super Erotic Marina Who Explodes Her Sexual Desire Without Being Accused Of Bei

  • amateur censoredamateurloglog-004log004535log-004
    • 2021-11-20
    61 min

    1Pondo 112021_001 The Throbbing: My Girlfriend Loves Giving Me a Head Early in the Morning Remi Fuyutsuki

  • amateur uncensored1pondo
    • 2021-11-22
    470 min

    [STTCD-052][Bargain Set] Getting Rei Kurumi Fucked By Everyone In The Stuff - Lewd Transsexual/Compliant Transsexual

  • walnut rei censoredcreampieSTTCDtrans clubtrans club discount setSTTCD-052STTCD052sttcd00052
    • 2021-12-03
    149 min

    [CAWD-309]"I Want To Scream I Love Sex!" Adult Debut of G-Cup Big Titted Cute Girl with Hakata Dialect Who Wants To Change Her Negative Approach To Sex! Tomoka Mamiya.

  • tomoka mamiya censoredbig titssquirtingCAWDkawaiimaeda bungouCAWD-309CAWD309cawd00309
    • 2021-12-03
    118 min

    [CAWD-315]Three Days Not Being Able To Contact Girlfriend On Camp. My Devoted Girlfriend Made To Cum Like Crazy By Lewd Ex-Boyfriend...Natsu Hinata

  • natsu hinata censoredcreampiebeautiful girlCAWDkawaiitaiga kosakaiCAWD-315CAWD315cawd00315
    • 2022-01-01
    160 min

    [LULU-113]"You"re Hesitant Even If We Fuck!？" I Was Rejected By Me First Girlfriend For Being Too Much Of A Cherry Boy, I Wear Glasses And Wasn"t Noticed Before By An Old Friend, A Gal With A Tan Ass, Now She"s My Sex Training Par

  • ranka censoredcreampiesingle workLULUlunaticsvagmanLULU-113LULU113lulu00113
    • 2022-01-06
    142 min

    [FANH-054]Legal Petite S*****t Matoi-chan (18) Erotic Goddess Meets Up Offline For Sex Thrust Into Beautiful Obedient Girl"s Womb And Fill With Cum

  • censoredcreampiesquirtingFANHhamedori.network secondeditionFANH-054FANH054h-1472fanh00054
    • 2022-01-06
    94 min

    [ETQR-333][Delusional Subjectivity] Drowning... A Fully Consensual Lascivious Girl Who Will Listen To Anything You Say... Delivered To You. Bust 92cm, Gcup, Belongs To The Volleyball Club, Height 170cm, Suzume.

  • censoredcreampiebig titsETQRerotic timeETQR-333ETQR333etqr00333



    • Japan xxx, japanese adult videos, japani sexy, Japanese Adult Movies, JAV censored, Japanese tube, Japanese sex online