high vision javcensored jav schoolgirl censored




FC2FSDSSBLKSSNIEBODMVSDSTARSCESDBBANWAAACHRVGMEMSPRDAVSASANMEYDHNDABWNACRDTTNGOD

2019-04-25
92 min

[SDMF-001]I Pay My Daughter For Sex. But She Doesn't Care About Me. Pink Family Vol. 3. Chiharu Miyazawa

  • chiharu miyazawa censoredschoolgirlsingle workSDMFsod createeasy matsumotoSDMF-001SDMF0011sdmf00001
    • 2019-04-25
    205 min

    [NHDTB-260]Pair Of Friends Testing Competition Molestation Schoolgirls Cum In Front Of Each Other

  • censoredschoolgirlNHDTBnatural highvanilla sakuraiNHDTB-260NHDTB2601nhdtb00260
    • 2019-04-24
    154 min

    [DWD-026]Private Video Posting. A Creepy Geek's Revenge Porn. Keiko Uehara & Aiko Kagura

  • censoredschoolgirlamateurDWDtamaya labelDWD-026DWD026h-580dwd00026
    • 2019-04-24
    120 min

    [DWD-032]Posting Personal Videos Creepy Otaku Revenge Video Ryoko Matsunaga & Sako Edition

  • censoredschoolgirlamateurDWDdogmak westDWD-032DWD032h-580dwd00032
    • 2019-04-21
    133 min

    [APNS-120]"My Reclusive Classmate And His Family Are Going To Rape And Impregnate Me... Every Day From Now On..." Momo Hazuki

  • hazuki peach censoredcreampieschoolgirlAPNSaurora project annexyukihiro nasuaurora project anexAPNS-120APNS120apns00120
    • 2019-04-21
    120 min

    [APNS-121]Endless Gang Rape And Torture. Angels Fall Into An Antlion Pit "We've Been Ruined... We Can't Go Back To Being Normal Again..." Ruru Arisu, Yui Tomita

  • have yu tomita censoredcreampieschoolgirlAPNSaurora project annexyukihiro nasuaurora project anexAPNS-121APNS121apns00121
    • 2019-04-19
    199 min

    [DOCP-139]Even My Serious Little Sister Masturbates... What？ She Orgasms That Wildly!？ Fucking And Creampie-ing My Little Sister's Pussy That Orgasms Continuously While She Feverishly Fingers Herself In Her Uniform!

  • shizuka sugisaki sakino flower censoredcreampieschoolgirlDOCPprestigedoc premiumDOCP-139DOCP139118docp00139
    • 2019-04-17
    139 min

    [DWD-017]Posting Personal Videos Creepy Otaku Revenge Video Sana Sakurai Edition & Makoto Oshimi Edition

  • censoredschoolgirlamateurDWDtamaya labelDWD-017DWD017h-580dwd00017
    • 2019-04-17
    130 min

    [GVG-860]Full Record Of Everything Private Tutor Did To Big Tits Student Hidden Camera File Mikari Ichimiya

  • ichinomiya mikari censoredbig titsschoolgirlGVGglory questGVG-860GVG86013gvg00860
    • 2019-04-15
    121 min

    [KTRA-113]Obedient Masochist Small Tits Schoolgirl Mika Tsukushi

  • tsukushika censoredcreampiebeautiful girlKTRAk tribeKTRA-113KTRA113h-094ktra00113
    • 2019-04-14
    123 min

    [MKON-007]That Time My School Crush Was Fucked Raw By The Handsome Boy In Class Mihina Azu

  • azumihina nagai mihina censoredcreampieschoolgirlMKONkaguyahimept mousouzokunortonmikonMKON-007MKON007mkon00007
    • 2019-04-14
    120 min

    [SUJI-106]Pretty Girls Kidnapped And Fucked Raw Against Their Will! Pitiful School Girls Forced To Take Cock

  • censoredcreampieschoolgirlSUJIkanranshaSUJI-106SUJI106suji00106
    • 2019-04-13
    405 min

    [HUNTA-581]"I Don't Have Much Experience But You Can Use Me To Practice Sex... You Can Mess Up As Many Times As You Want..." Sex Practice With A Kind Classmate! Recently Everyone At School Found Out That I'm A Cherry Boy And Now I Get

  • censoredcreampieschoolgirlHUNTAhuntervolvo nakanohhh groupHUNTA-581HUNTA581hunta00581
    • 2019-04-13
    458 min

    [AP-652]Super Selections! New Year's Exclusive Footage! Molester Appreciation Fair No.3 15 "Sch**lgirl" Victims Special!

  • censoredschoolgirlAPapachekuniokahhh groupAP-652AP652ap00652
    • 2019-04-13
    240 min

    [HUNTA-584]My Stepsister Has A Super Beautiful Ass And Her Ass Cheeks Peek Out From The Bottom Of Her Hot Pants! My New Younger Stepsister Has A Beautiful, Sexy Ass!! Pantyshot Under The Skirt Of Her Uniform! Her Loungewear Shorts! But Above All, Her

  • censoredschoolgirlsisterHUNTAhunterkawajirihhh groupHUNTA-584HUNTA584hunta00584
    • 2019-04-13
    120 min

    [SSNI-460]Her Looks Of Hatred And Sensitive Body Are Too Much To Handle So I Relentlessly Pound This Uniformed School Girl From All Directions Mei Hata

  • field mei censoredschoolgirldeepthroatSSNIs1 no 1 styleichigoharaSSNI-460SSNI460ssni00460
    • 2019-04-12
    145 min

    [SUPA-448]A Sc**lgirl Gal Debut!! Meet Mika From Adachi Ward

  • censoredcreampieschoolgirlSUPAskyu shirotok taroSUPA-448SUPA448h-244supa00448
    • 2019-04-12
    150 min

    [MDS-889]When I Tried To Ruin Her Promising Future By Giving Her A Creampie She Started To Fight Back Frantically. She Looked So Endearing... Rape Destroys Her Wonderful Life In A Girls' Dormitory

  • arisaka miyuki hikaru minazuki censoredcreampiesquirtingMDSmedia stationjohnny shibuyauchu kikakuMDS-889MDS88961mds00889
    • 2019-04-12
    160 min

    [MDBK-015]Secret Impregnation Date With A Cute, Young, Rental Girlfriend

  • arisaka miyuki abe mikako censoredcreampiesquirtingMDBKmedia stationk tarobazookaMDBK-015MDBK01561mdbk00015
    • 2019-04-12
    142 min

    [VRTM-423]"I Just Want To Grope That Ass, Just Once!" Her Daddy Was Feeling Horny For His Daughter's Big Ass Every Time He Saw It Wrapped In Black Pantyhose And Her School Uniform, So One Day He Slipped Her Some Date Rape Drugs, And Made

  • kuraki bookmark hikaru minazuki censoredcreampieschoolgirlVRTMv r produceyamanaka socksVRTM-423VRTM423h-910vrtm00423
    • 2019-04-12
    123 min

    [FONE-055]3 Fresh Graduates Make Their Soaring Debuts!

  • censoredcreampieschoolgirlFONEfirst stardiscoveryFONE-055FONE055h-491fone00055
    • 2019-04-12
    149 min

    [SUPA-447]Lecherous Old Man Fucks A School Girl Raw And Films It In Return For Money

  • censoredcreampieschoolgirlSUPAskyu shirototetSUPA-447SUPA447h-244supa00447
    • 2019-04-11
    192 min

    [NHDTB-255]A Sch**lgirl Who Got Gang Bang Fucked By An Exhibitionist Gang

  • censoredschoolgirlNHDTBnatural highvanilla sakuraiNHDTB-255NHDTB2551nhdtb00255
    • 2019-04-11
    135 min

    [SDMM-014]A Schoolgirl Sucks A Black Man's Mega Dick For The First Time And Gags. The Magic Mirror

  • censoredamateurdeepthroatSDMMsod createbacon tanakamagic mirrorSDMM-014SDMM0141sdmm00014
    • 2019-04-11
    160 min

    [IENE-990]She Wanted His Cock So Badly Her Pussy Was Twitching And Trembling! She Was Dripping Her Pussy Juices All Over His Cock And Now It Was Soaking Wet! When These Schoolgirls Started Pussy Grinding These Dirty Old Men, Things Got Really Naughty

  • censoredschoolgirlamateurIENEienergytiger kosakaiie nergyIENE-990IENE9901iene00990
    • 2019-04-11
    130 min

    [SDAB-087]Nazuna Nonohara x Hinata Koizumi SOD Star x Passionate Youth Double Stars These 2 Childhood Friends Gave Their Favorite Boy Some Horny Hospitality A Dream-Cum-True Reverse Threesome Academy

  • nazuno nonohara hinata koizumi censoredbig titsschoolgirlSDABsod createkomatsu 17one s youthSDAB-087SDAB0871sdab00087
    • 2019-04-11
    240 min

    [PIYO-026][Perverted Desires] A Secretly Dirty Girl Who Attends A Girls' Combined Junior High And High School Is Surprisingly Shy, Extremely Submissive And Loves To Deep Throat. Her White Body Flushes As A Middle-Aged Man Greedily Has His Way Wit

  • censoredschoolgirlPIYOhyokopiero daPIYO-026PIYO0261piyo00026
    • 2019-04-10
    197 min

    [EQ-447]I Got Remarried To A Woman With A Schoolgirl Daughter Who Was Easy Prey For My Out-Of-Control Creampie Raw Footage Rampage! 3

  • yuri fukada shino asahina censoredcreampiebig titsEQbullittamateur drama lovers clubitazuraEQ-447EQ447h-100eq00447
    • 2019-04-08
    86 min

    [HOKS-023]Pleasurable Hot Plays Poor Stepsisters In A Crummy Apartment

  • south ryo one thousand three bells censoredschoolgirlsisterHOKSfa proanaconda anarchyHOKS-023HOKS023hoks00023
    • 2019-04-07
    119 min

    [MIAA-054]I Have A Girlfriend For The First Time In My Life So I Practiced Sex And Creampies On My hildhood Friend. Akari Mitani

  • mitani akari censoredcreampieschoolgirlMIAAmoodyzeveryone s porn starMIAA-054MIAA054miaa00054
    • 2019-04-07
    119 min

    [MIDE-642]Girl In School Uniform And No Panties Shows Off Her Sweet Anus As She Works Around The House Mia Nanasawa

  • nanasawa mia censoredanalschoolgirlMIDEmoodyzdragon nishikawamoodyz divaMIDE-642MIDE642mide00642
    • 2019-04-05
    121 min

    [KCDA-253]Super Mini Skirt High School Girls Cowgirl 20 Girls

  • censoredbig titsschoolgirlKCDAdigital arkdigital ark digital arkKCDA-253KCDA253kcda00253
    • 2019-04-04
    172 min

    [GDHH-145]This Prim And Proper Sch**lgirl Who Wears Glasses And Knee-High Socks Is, To Our Surprise, Wearing A Thong! Knee-High Socks x Thong Panties Is Getting Us Excited To The Max! She's So Sexy, Of Course We're Getting A Full Erection!! I

  • censoredcreampieschoolgirlGDHHgolden timekorosukehhh groupGDHH-145GDHH145gdhh00145
    • 2019-04-04
    173 min

    [SSNI-447]Sex-Loving Miru Sakamichi's Horny, Erotic Massage Parlor Special With Lots Of Ejaculations ~Dedicated Service, 170-Minute VIP Course

  • see the slope censoredsquirtingschoolgirlSSNIs1 no 1 styleusa pyonSSNI-447SSNI447ssni00447
    • 2019-04-04
    330 min

    [HUNTA-575]"No! Your Dick Is Inside My Pussy!! Please Stop!!" I Was Pussy Grinding With My Excessively Cute, Secretly Horny Childhood Friend, When My Dick Just Slipped Inside! It Felt So Good That I Kept It In There For Some Creampie Raw Foot

  • censoredcreampieschoolgirlHUNTAhuntervolvo nakanohhh groupHUNTA-575HUNTA575hunta00575
    • 2019-04-04
    457 min

    [HUNTA-578]A Childhood Friend Variety Project A 3-Video Special (Practice Sex With My Slutty Childhood Friend & My Childhood Friend Is Dating This Shitty Asshole That I Know! And This Shitty Asshole Is Showing Off How Sexy My Childhood Friend Look

  • censoredcreampieschoolgirlHUNTAhuntermorikihhh groupHUNTA-578HUNTA578hunta00578
    • 2019-04-04
    209 min

    [OYC-245]You Have 1 Minute To Think About It. The Ultimate 2 Choices! 1. You Can Stay Awake While I Fuck You 2. You Can Take A Sleeping Pill And By The Time You Wake Up, It Will All Be Over The Time Has Cum For Me To Get Revenge On This Girl That Had

  • censoredcreampieschoolgirlOYCoyashoku.companysleggerhhh groupOYC-245OYC245oyc00245
    • 2019-04-04
    189 min

    [OYC-244]This Girl From My Class Who's Always Bullying Me Has Finally Cum To My House! So I Planted Hidden Cameras And Recorded The Whole Incident. When I Told Her That I Had Proof That She Was Bullying Me, Her Attitude Suddenly Changed... And No

  • censoredschoolgirlOYCoyashoku.companytoguro sistershhh groupOYC-244OYC244oyc00244
    • 2019-04-04
    158 min

    [SSNI-448]My Girlfriend's Little Sister Seduces Me With Her Bra-Less I-Cup Tits And I Can't Resist Her. Shion Yumi

  • evening beauty censoredbig titsschoolgirlSSNIs1 no 1 stylekyoseiSSNI-448SSNI448ssni00448
    • 2019-04-04
    236 min

    [HUNTA-576]I Was Super Angry, So I Shoved My Rock Hard Cock Into My Little Stepsisters Mouth, And To My Surprise, Things Turned Out To Be Divine!! I Got A New Little Stepsister-In-Law, And She's Super Cute! But She's Got A Super Bad Personali

  • censoredschoolgirlblowjobHUNTAhunterkawajirihhh groupHUNTA-576HUNTA576hunta00576
    • 2019-04-04
    168 min

    [OYC-246]I'm A Shut-In, And I Spend All Day Observing My Little Sister Through The Peeping Hole In My Room. But One Day, As I Watched Her And Her Boyfriend Fucking, Our Eyes Met, And That Got Her Even Hornier...？

  • censoredschoolgirlsisterOYCoyashoku.companytoguro sistershhh groupOYC-246OYC246oyc00246
    • 2019-04-01
    117 min

    [DOKS-476]The Daydream Fantasy Examination Club Hidden Dripping Wet Pussy Motives

  • miho yui yuri mochida censoredschoolgirlblowjobDOKSoffice k sforever youngDOKS-476DOKS47636doks00476
    • 2019-04-01
    112 min

    [TWT-028]Girls In Uniform Who Love Masturbation Are Luring You To Panty Shot Dirty Talk Temptation 2

  • censoreduniformschoolgirlTWTsarutoru video publishertwin tailsTWT-028TWT028h-897twt00028
    • 2019-04-01
    271 min

    [DOKS-479]Filthy Medical Examinations By A Perverted Doctor Who Relentlessly Palpates The Nipples Of Girls In Uniform! Schoolgirl Nipple Examination Collection. 4 Hours And 30 Minutes

  • south star love mari rika censoredbig titsuniformDOKSoffice k sDOKS-479DOKS47936doks00479
    • 2019-04-01
    233 min

    [AMBS-053]All Out! Shuri Atomi

  • atomi shuri censoredcreampieschoolgirlAMBSplanet plusanbibaresotsuAMBS-053AMBS053h-237ambs00053
    • 2019-03-31
    90 min

    [HOKS-021]Ward of 18 Year Olds Satomi Suzuki

  • satomi suzuki censoredbig titsschoolgirlHOKSfa proanaconda anarchyHOKS-021HOKS021hoks00021
    • 2019-03-31
    244 min

    [KTKY-036]"We Live In The Country, And There's Nothing To Do Out Here But Fuck!" Nationwide Barely Legal Girls Pictorial 4 Hours

  • censoredcreampieschoolgirlKTKYkitixx mousouzokuKTKY-036KTKY036ktky00036
    • 2019-03-30
    118 min

    [MIAA-048]My Little Sister Is Tempting Me With Facefucking,

  • mitani akari censoredschoolgirlblowjobMIAAmoodyzsuisei akaieveryone s porn starMIAA-048MIAA048miaa00048
    • 2019-03-29
    243 min

    [SIM-031]I Got Super Excited For A Sch**lgirl In Knee-High Socks And The Total Domain Of Her Hot Thighs...

  • censoredcreampieschoolgirlSIMprestigeamateur pussiesSIM-031SIM031118sim00031
    • 2019-03-28
    138 min

    [GODR-915]Naive Schoolgirl Panty Shot Festival Panty Shots Have Nothing To Do With It!! Erotic Limbo Dance Punishment Game

  • censoredschoolgirlGODRviphasshigodGODR-915GODR91578godr00915
    • 2019-03-27
    215 min

    [FSKI-002]"I Can't Say No..." They Thought They Were Safe With A Female Masseuse At A Massage Parlor, But She's Suddenly Switched To A Male Masseur？! Beautiful Young Girls In Uniform Are Sweet-Talked Into Letting The Man Give Them An

  • censoredcreampiesquirtingFSKIfirst starultimate planFSKI-002FSKI002h-491fski00002
    • 2019-03-27
    145 min

    [FNEO-015]Girls Who Unintentionally Accentuate Their Tits With The Straps Of Their Purses On The Bus Are So Cute...

  • censoredbig titsschoolgirlFNEOfirst starfirst star neoFNEO-015FNEO015h-491fneo00015
    • 2019-03-26
    115 min

    [KTRA-110]A Perverted, Beautiful Young Sub In Uniform. Trained In A Dirty Room. An Wakamoto

  • ann wakamoto censoredcreampieschoolgirlKTRAk tribeKTRA-110KTRA110h-094ktra00110
    • 2019-03-26
    125 min

    [KTRA-109]A Beautiful Real Masochist. Thick Creampies. Yui Tomita

  • yu tomita censoredcreampieschoolgirlKTRAk tribeKTRA-109KTRA109h-094ktra00109
    • 2019-03-23
    148 min

    [DBER-027]Club For Seekers Of The Bizarre And The Obscene ~A Bewitching Beauty's Orgasm Hell~ Part 1: The Tragedy That Befell Chiharu, A Pretty Honor Student. Chiharu Miyazawa

  • chiharu miyazawa censoreduniformschoolgirlDBERbabyentertainmentkikubonred babeDBER-027DBER027dber00027
    • 2019-03-22
    200 min

    [BAZX-178]Sexual Acts With Sch**lgirls In Scarves Who Want To Get Raped vol. 001

  • censoredcreampieschoolgirlBAZXmedia stationtodobazookaBAZX-178BAZX17861bazx00178



    • Japan xxx, japanese adult videos, japani sexy, Japanese Adult Movies, JAV censored, Japanese tube, Japanese sex online