high vision big tits orgy jav javcensored




FC2JULAUKGCHRVSPRDDASDDASDFSDSSSTARSMEYDAVSAAPODJUFENGODMVSDHODVKBIVENXSDABPPPDAUKG

2020-11-22
148 min

[CAWD-139]"The Midsummer Heat Seems To Be Making Me Crazy..." Homestay Business Trip NTR: I Want To Forget My Husband And Everyday Life. I Fell To The Temptation Of My New Female Subordinate And Drowned In A Forbidden Fruit For 3 Days - Mayuk

  • maiyuki ito censoredcreampiesingle workCAWDkawaiimonchanCAWD-139CAWD139cawd00139
    • 2020-11-22
    49 min

    1Pondo 112220_001 Model Collection: Emi Aoi

  • amateur uncensored1pondo
    • 2020-11-27
    102 min

    [YST-233]Miserable Step--parents - Mitsuha Higuchi

  • mitsuha higuchi censoredcreampiedeepthroatYSTkomyoYST-233YST233540yst00233
    • 2020-12-06
    240 min

    [MMB-338]There's Nothing Better Than The Thrill Of Sex In The Afternoon - 10 Horny Housewives Who Love Creampie Sex And Keep On Fucking Even When Visitors Cum Calling -

  • aki sasaki kina shinozaki censoredcreampiemature womanMMBmomotaro eizohakase ishikiribashimomotaro s bestMMB-338MMB338mmb00338
    • 2020-12-10
    150 min

    [RCTD-368]The Genuine Article The Watch That Can Make Time Stop Part 20 Yuria Yoshine

  • yoshine yuria censoredbig titssingle workRCTDrocketroute yamazakiRCTD-368RCTD3681rctd00368
    • 2020-12-17
    100 min

    [BAKU-004]Bondage Fakecest~ Step-Son Gets Kinky With Stepmother Using A Hemp Rope, And Makes Her Cum - With Mayuko Okamura

  • mayuko okamura censoredcreampiemature womanBAKUcenter villagedaichi minamizegu center villageBAKU-004BAKU004h-086baku00004
    • 2020-12-24
    47 min

    [NYH-076]Horny MILF Trains Her Son's Friends' Eager Young Cocks Yurika Aoi

  • yurika censoredbig titsmilfNYHdirectorsdirectorsnyanjiang houseNYH-076NYH0761nyh00076
    • 2020-12-27
    120 min

    [MRSC-007]Picking Up Amateur Housewives And Asking Them To Watch Us Jack Off 2 All You Have To Do Is Watch! So, Would You Take A Look At My Cock Too？ 10 Ladies

  • censoredamateurblowjobMRSCmisesu no sugao emmanuelleokina tsumadorinomisses amateur faceMRSC-007MRSC007mrsc00007
    • 2021-01-06
    53 min

    [sika-002]あみ＆りか

  • amateur censoredcreampieuniformsikasika-002sika002sika-002
    • 2021-01-17
    128 min

    [BHG-037]BUSTY BABES - Married Amateurs Welcome! Honami

  • censoredcreampiebig titsBHGgain corporationBHG-037BHG037bhg00037
    • 2021-01-21
    125 min

    [FSDSS-158]We Won't Let Them Go Even If Their Hips Crack From The Pressure! Back-Handle-Standing-Fucks For Always Penetrating Those Pussies Deep To Their Cores Tina Nanami

  • nanami tina censoredsingle workFSDSSfalenoyamaguchi memberfaleno starFSDSS-158FSDSS1581fsdss00158
    • 2021-02-11
    135 min

    [SW-756]I Like Older Men. My Friend's Little Sister Was Totally My Type, And She Was The Kind Of Sch**lgirl Who Loved To Lure Men To Temptation! She Got Me Hot And Hard With Her Total Domain Of Knee-High Socks, And Tempted Me With Her Sweet Voice

  • kagami sara censoredschoolgirlsingle workSWswitchSW-756SW7561sw00756
    • 2021-02-19
    198 min

    [GZAP-042]I Left My Well-Trained Fuck Buddy Nude Out In Public So Please Go Ahead And Give Her A Creampie Fuck In The Open Air

  • censoredGZAPprestigezapGZAP-042GZAP042118gzap00042
    • 2021-02-27
    79 min

    355OPCYN-148 Asuka

  • amateur censoredamateurbeautiful girlopcynopcyn-148opcyn148355opcyn-148
    • 2021-02-27
    63 min

    FC2PPV 1703604 [Limited sale until 3/7] Surprise surprise! I will visit Virgin-kun’s room alone with a beautiful girl! When I thought that the shooting was over with the brush down from the entrance immediately, on the contrary, the former virgi

  • amateur uncensoredfc2
    • 2021-03-12
    143 min

    [FONE-137]"I'm Embarrassed About My Long, Sensitive Nipples" Slender Beautiful College Dream Girl's Nipples Are Always Erect

  • censoredamateurbeautiful girlFONEfirst starplus first starFONE-137FONE137h-491fone00137
    • 2021-03-16
    52 min

    C0930 ki210316 Natsuko Hayasaka 18years old

  • amateur uncensoredc0930
    • 2021-03-19
    57 min

    [ETQR-210](Daydream POV Fantasies) Deep And Rich Sex With A Gorgeous Office Lady Yukine

  • censoredcreampieuniformETQRerotic timeETQR-210ETQR210h-1186etqr00210
    • 2021-04-03
    243 min

    [MLSM-041]Top Class Beautiful Mature Women Best Yumi Kazama 4 Hours Big Round Ass Madonna

  • kazama yumi censoredcreampiebig titsMLSMmellow moonMLSM-041MLSM041mlsm00041
    • 2021-04-22
    39 min

    FC2PPV 1782220 [No / Mufufu benefits available] The plump big breasts girl who sticks out the side milk likes cock more than electric massage! ？？ The practitioner’s thing is lively and SP massage is begging! * 3 major review benefits available

  • amateur uncensoredfc2
    • 2021-04-26
    53 min

    492JCHA-032 It’s awkward to negotiate a vaginal cum shot for a kid! Immediately Saddle Immediately

  • amateur censoredcreampieuniformjchajcha-032jcha032492jcha-032
    • 2021-05-07
    119 min

    [MEYD-672]Goro Tameike 15 Year Anniversary Collaboration Number 4 My Friend's Mother I Was Seduced By My Son's Friend And Made To Cum Over And Over... Yuko Shiraki

  • shiraki yuko censoredcreampiebig titsMEYDtameike goroshiro shotenMEYD-672MEYD672meyd00672
    • 2021-05-19
    30 min

    396BIG-105 Hina

  • amateur censoredcreampieschoolgirlbigbig-105big105396big-105
    • 2021-05-19
    37 min

    FC2PPV 1826072 [No] [Limited to 100 pieces 2980 → OFF to 1480pt!] The long-awaited sequel to a beautiful beauty who is too beautiful ♥ ️ I’m doing something more erotic than the previous work! * Review benefits / Shivering ♥ Denma masturbation ♥

  • amateur uncensoredfc2
    • 2021-05-28
    118 min

    [WAAA-069]This Super Sexy Lady Boss Planned For Us To Be Booked Into The Same Room Together So She Could Suck My Cock And Hit Me With Reverse NTR Action She Pressed Her Voluptuous Big Titties And Ass Into Me For A Creampie Fuck Fest And Sucked 10 Eja

  • nene tanaka censoredcreampiebig titsWAAAwanz factorywanzWAAA-069WAAA069waaa00069
    • 2021-06-01
    120 min

    [NACR-424]The Wife Next Door With Giant Tits Accidentally Entered The Wrong House Yuri Honma

  • really censoredcreampiebig titsNACRplanet plusdirector onanakuruNACR-424NACR424h-237nacr00424
    • 2021-06-04
    147 min

    [NKKD-209]Wife Wraps Younger Boy's Cock In Her Freshly Disrobed Panties And Jerks Him Off Riho Fujimori

  • riho fujimori censoredbig titsslutNKKDjet eizomanji groupNKKD-209NKKD209nkkd00209
    • 2021-06-17
    98 min

    [HTHD-187]My Friend's Mother - The Final Chapter - Kyoko Tachikawa

  • kyoko tachikawa censoredcreampiemature womanHTHDcenter villagedaichi minamihona zonoHTHD-187HTHD187h-086hthd00187
    • 2021-07-03
    109 min

    [AWD-127]All In The Family: My Stepmom's Perfect Ass - Ultra-Thick! My Hot, Voluptuous Stepmom's Bangin' Booty Sae Asaoka

  • asaoka sae censoredbig titsmature womanAWDrubysusumu yanokuchinext doorAWD-127AWD127awd00127
    • 2021-07-31
    58 min

    Pacopacomama 073121_509 She Got A Sex Toy In Her Vagina: Cute And Sophisticated Looking Wife Is So Horny! Hitomi Okano

  • amateur uncensoredpacopacomama
    • 2021-08-28
    69 min

    200GANA-2551 Picking Up Girls In Geki Kawa Yukata In Asakusa! A moody girl who pretends to be neat and mature … and accepts H invitations with a shy smile! Yukata that opens! Enchanted Momojiri! This is a summer tradition!

  • amateur censoredamateurganagana-2551gana2551200gana-2551
    • 2021-08-31
    62 min

    FC2PPV 2113329 4 Days Limited Special Price !! [Peculiar Strong Woman ＃ 012] Iku Beauty Ol 28 Years Old With A Generalized Erogenous Zone Trained Woman Endless Nipple Groping Mad Fainting Acme Broken Kimepako ♡

  • amateur uncensoredfc2
    • 2021-09-02
    200 min

    [ABW-140]女子マネージャーは、僕達の性処理ペット。 040 唯月優花 【MGSだけのおまけ映像付き 15分】

  • amateur censoredbig titsamateurabwabw-140abw140abw-140
    • 2021-09-17
    120 min

    [PRED-339]"Even If We Commit Infidelity, No One Will Ever Find Out, Right ...？" I Was Posted To This City, Away From My Family, And To My Surprise, I Discovered That My Neighbor Was A Colleague From Work. Minami Hatsukawa

  • hatsukawa minami censoredcreampieslutPREDpremiumtorendei yamaguchielegancePRED-339PRED339pred00339
    • 2021-09-18
    60 min

    FC2PPV 2217337 * Weekend Limited 4980⇒2980 ★ First Shot ☆ Valuable! Shy ♥ Natural Moody Erotic Beautiful Girl ♥ Koume-Chan 18 Years Old ☆ Undeveloped Pussy With One Male Experience ♥ Agony Wet Wet ♥ First Vaginal Cum Shot Large Amount Of Semen Inject

  • amateur uncensoredfc2
    • 2021-09-23
    125 min

    [ARMF-019]Beautiful Secretary Full-body Encyclopedia No.2

  • aya mamiya ikuta miku censoredanalARMFaroma kikakunyotai fetishismARMF-019ARMF019armf00019
    • 2021-10-01
    125 min

    [CAWD-298]Half Swedish Girl With Huge Ass Loves Japanese Porn, Dressed Up In Cosplay And Got Fucked Over And Over Uika Noa

  • squid censoredcreampiecosplayCAWDkawaiiarashiyama michiruCAWD-298CAWD298cawd00298
    • 2021-10-02
    124 min

    [MOPT-011]The Masochistic Male Is A Living Creature That Is Tied Up. Getting Tied Up By A Slut, The Masochism Switches On. Miho Tomii

  • miho tomii censoredanalslutMOPTm o paradisemo tightMOPT-011MOPT011mopt00011
    • 2021-10-06
    49 min

    229SCUTE-1133 Mahiro (25) S-Cute Delicate Black-Haired Loli Girl And Naughty (Mahiro Ichiki)

  • amateur censoredamateurbeautiful girlscutescute-1133scute1133229scute-1133
    • 2021-10-08
    38 min

    FC2PPV 2310228 First And Last Appearance! !! Limited Number! [Uncensored] Beautiful Proportions That Won The Former Beauty Pageant Grand Prix. Creampie On The Sensitive Body Of A Beautiful Woman Who Also Handles Fashion Models! !! This Is Her Last Wo

  • amateur uncensoredfc2
    • 2021-11-01
    122 min

    [GOJU-190]"My Husband Won"t Look At Me As A Woman." A Wife With Colossal Tits Pleads To Appear In Porn Out Of A Desire To Still Indulge As A Woman Ms. Chiaki Age 48

  • censoredbig titsamateurGOJUisojinGOJU-190GOJU190h-1165goju00190
    • 2021-11-05
    85 min

    FC2PPV 2404542 CP0138 Cowgirl Super Horse Prickets Gal 2nd! Rich Creampie In Uniform Costume Misa ❤ Shaved ❤ Uncut ❤ Oni Close-Up ❤ Subjective ❤ Super High Quality ❤ 4k60fps ❤

  • amateur uncensoredfc2
    • 2021-11-11
    124 min

    [IESP-688]Kaede Hiiragi S********l 20 Consecutive Creampie

  • hiiragi kaede censoredcreampiesingle workIESPie nergykiku riniespIESP-688IESP6881iesp00688
    • 2021-11-17
    66 min

    FC2PPV 2440091 A Beautiful Slender Who Works At A Bank Counter For The Second Year As A Member Of Society. Did She Regret Her Last Time？ She Begged For Vaginal Cum Shot.

  • amateur uncensoredfc2
    • 2021-11-23
    41 min

    H0930 ki211123 Maya Okada 30years old

  • amateur uncensoredh0930
    • 2021-12-03
    28 min

    FC2PPV 2484896 [Personal Shooting] A 21-Year-Old Former Men’s Beauty Salon Clerk Who Became A Little Adult ①

  • amateur uncensoredfc2
    • 2021-12-03
    137 min

    [NNPJ-485]This Babe With Secretly G-Cup Big Tits Will Do Anything For Money A Big Titty College Girl With A Great Personality And A Cheerful Demeanor Is Going To Give You 5 Raw P*ssy Cum Shots

  • censoredcreampiebig titsNNPJnampa japanNNPJ-485NNPJ485nnpj00485
    • 2021-12-04
    119 min

    [XVSR-626]Sex Filming Yui Hatano in Private!

  • yui hatano censoredcreampiebeautiful girlXVSRmax ayoshida ikuzoucalenXVSR-626XVSR626xvsr00626
    • 2021-12-06
    79 min

    259LUXU-1509 Luxury TV 1492 Adult Cute Thirty Married Woman With Attractive Eyes That Seems To Be Sucked In After Worried About Sexless, AV Shooting! A Rich And Intense Kiss And Piston That Provokes M, A Beautiful Face That Strangles The Neck Turns I

  • amateur censoredbig titsmarried womanluxuluxu-1509luxu1509259luxu-1509
    • 2021-12-24
    138 min

    [ROE-033]Mariko Shizuka, 42, Makes Her Adult Film Debut, A Brilliant English Teacher Who Can"t Show Her S*****ts Or Husband What She"s Really Like Behind The Scenes!

  • shizukawa mariko censoredbig titsmature womanROEmadonnamametaro mamezawamonroeROE-033ROE033roe00033
    • 2022-01-07
    41 min

    359TYVM-223 I Love Being Attacked With A Fierce Pinton! The Shameless Appearance Of Mom Who Can Not Be Shown To Her Son! Grab A Big Ass And Have Sex With A Vaginal Cum Shot! (Sakuno Mayu)

  • amateur censoredcreampiemarried womantyvmtyvm-223tyvm223359tyvm-223
    • 2022-01-10
    25 min

    FC2PPV 2581593 Limited Number! !! [Uncensored] A Big Tits Cafe Clerk Who Is Kind On The Way Home From Work And Obscene Fornication … Bring It To The Room And Put Out Shame On The Too Nasty Sensitive Body Of Fair-Skinned Fcup! !!

  • amateur uncensoredfc2
    • 2022-01-14
    79 min

    529STCV-051 [Neat And Clean Bitch Who Seduces Classmate Boys With Fluffy H Cup Milk] Jun-Chan And Jun-Chan Of The Table Tennis Club Who Ate All The Boys Of The Same Club Activities! A Genuine Bitch That Is Called "Always A Vagina" At School!

  • amateur censoredcreampiebig titsstcvstcv-051stcv051529stcv-051
    • 2022-01-15
    162 min

    [MMYM-052]Dirty Talking Obscene Woman Alice Otosu"s Plump And Round Thighs And Big Breasts Get Rubbed And Licked

  • otsu alice censoredbig titsslutMMYMmarrionyumeno aidayumenoMMYM-052MMYM052mmym00052
    • 2022-01-18
    17 min

    FC2PPV 2602672 [Personal Shooting / Gonzo] Gonzo Is Taken By Leaving The Child In A Nursery, The Married Woman Is Betrayed Because She Became A Guarantor Of An Acquaintance, And The Body Collapses By Forced Vaginal Cum Shot

  • amateur uncensoredfc2
    • 2022-01-31
    58 min

    328HMDN-449 [Neat Wife’s Back Face] Mama’s Valley Black Hair Short Tall Plump Masochist Wife 33 Years Old Husband Official Gonzo Dirty Talk Cum Shot Appeal Ahegao Continuous Cum Conceived Ntr [Hentai Couple] (Hirai Shirina)

  • amateur censoredcreampiemarried womanhmdnhmdn-449hmdn449328hmdn-449



    • Japan xxx, japanese adult videos, japani sexy, Japanese Adult Movies, JAV censored, Japanese tube, Japanese sex online