exclusive jav javcensored toy censored




FC2MIDVNACXDASDAUKSMVSDCESDNACRHMNAVSASHKDSQTENNPJADNGVHDASDBBANPPPDNGODJUFESTARS

2020-09-27
94 min

345SIMM-516 Delusional masturbation with boys in class! ？？ 169cm model body, Takamine’s flower of the tennis club is a moody onanist! Electric massage, urination, footjob, raw squirrel … I love everything that feels good ♪ Hedonistic J ○ an

  • amateur censoredcreampieuniformsimmsimm-516simm516345simm-516
    • 2020-10-05
    60 min

    469AHN-005 Kurumi

  • amateur censoreduniformamateurahnahn-005ahn005469ahn-005
    • 2020-10-11
    105 min

    [KIMU-013]Enjoyable Compensated Dating With A Cute Female S*****t With A Sweet Smile, Who Raw Fucks A Pathetic Uncle Steps On His Dick After School! Pervert Life, Rino Hazuki

  • rino hazuki censoredschoolgirlbeautiful girlKIMUavs collector shiroyukifresh babe avs collector sKIMU-013KIMU013kimu00013
    • 2020-10-23
    240 min

    [MBM-226]No Parent Should Have To See This Video An Innocent Barely Legal Babe Gets Her Pussy Pumped Deep To Creampie Oblivion... As She Cums With Teary Eyes 4 Hours Her Innocent Pussy Is Destroyed With Shameful Sex 8 Babes Exposed In This Undergroun

  • censoredcreampieuniformMBMprestigegaro sasazukambmMBM-226MBM226118mbm00226
    • 2020-10-29
    13 min

    FC2PPV 1550979 * Sale limited 150 pieces 2560pt → 1480pt [Personal shooting] The long-awaited vaginal cum shot in the slender JD G cup ♪ Trilogy of big breasts! ？？ Part ③ [Mayuko-chan] Final SP

  • amateur uncensoredfc2
    • 2020-10-30
    53 min

    320MMGH-284 Lewd girl who got estrus by mutual masturbation for the first time ○ Raw Miku (18) F cup

  • amateur censoreduniformschoolgirlmmghmmgh-284mmgh284320mmgh-284
    • 2020-11-01
    306 min

    [DKSB-090]No Script, No Director! These Amateur Girls Are Here For Your Spank Bank Enjoyment Only! Mouthwatering Masturbation Material!

  • censoredamateurblowjobDKSBoffice k sk s bestDKSB-090DKSB09036dksb00090
    • 2020-11-19
    51 min

    C0930 ki201119 Shinobu Igarashi 20years old

  • amateur uncensoredc0930
    • 2020-11-26
    76 min

    432YKMC-041 Yume

  • amateur censoredcreampiebig titsykmcykmc-041ykmc041ykmc-041
    • 2020-11-26
    205 min

    [PIYO-095]Hyoko Anniversary Celebration. Y********ls Who Can't Refuse - And The Older Guys Who Want To Give Them Creampies...

  • censoredcreampiesquirtingPIYOhyokopiero dagrey wolfPIYO-095PIYO0951piyo00095
    • 2020-12-06
    126 min

    [STC-061]Fucked By A Japanese Man! Pregnant Blonde Foreign Girl Gets Railed! Spread Her Legs Wide, Fuck Her Hard And Fill Up Her Pussy With Cum Over And Over Again Until She Regrets Being Born A Woman!

  • censoredcreampiebdsmSTCspartan mousouzokuspartanSTC-061STC061stc00061
    • 2020-12-10
    124 min

    [FSDSS-139]Welcome To The Massage Parlor That Specializes In Milking Submissive Men Even After They Blow A Huge Load Nen Yoshitaka

  • nine yoshitaka censoredhandjobsingle workFSDSSfalenogoemonfaleno starFSDSS-139FSDSS1391fsdss00139
    • 2020-12-11
    37 min

    480FRIN-011 > Cosmetics CM image character Former model, female president SA. Leaked video of secret meeting hotel SEX with investors

  • amateur censoredamateurfrinfrin-011frin011480frin-011
    • 2020-12-15
    61 min

    1Pondo 121520_001 Great Shooting: Yui Minami

  • amateur uncensored1pondo
    • 2021-01-22
    63 min

    [DHT-197]Picking Up First-Rate MILFs - Beautiful Mature Creampie Sex JAPAN - Ms Kasumi, Age 41

  • censoredmarried womanamateurDHThot entertainmentstudio zeroDHT-197DHT19759dht00197
    • 2021-01-24
    76 min

    300NTK-507 Bashabasha Squirting Angel Class Beautiful Girl Advent! !! Still growing Echi Echi F cup is also Binkan’s generalized erogenous zone Natural boned nasty the etch SEX In addition, lewd goddess! !! Of course, the fluffy famous instrumen

  • amateur censoredcreampiesquirtingntkntk-507ntk507300ntk-507
    • 2021-01-30
    73 min

    200GANA-2428 Seriously Nampa, first shot. 1589 Marshmallow huge breasts spilling from the bra! A ridiculously elastic Momojiri! A beautiful man full of mellow man juice! I’m planning to catch a girl with rainbow cotton candy as bait in Shibuya i

  • amateur censoredbig titsamateurganagana-2428gana2428200gana-2428
    • 2021-02-04
    49 min

    FC2PPV 1671341 [Snow 〇 Ku] This is the last! Shaved snow 〇 Saddle with Kukos! Unbearably vaginal cum shot! !! Serious angel! !! Honoka-chan, goodbye, thank you * Complete appearance

  • amateur uncensoredfc2
    • 2021-02-18
    155 min

    [MVSD-454]A College Girl Who Had Fallen So Far, She Was Now Working At A Low-Class Raw Fuck Soapland I Hated My Homeroom Professor So Bad I Could Die, But Now I Had To Service His Cock And Do As He Said And He Creampie Fucked Me. Rei Kuruki

  • satoshi kuruki censoredcreampiesquirtingMVSDm s video groupMVSD-454MVSD454mvsd00454
    • 2021-02-21
    233 min

    [REXD-352]Good Luck Has Come! Piledriving Her Into The Ground! "I Guess You Can Smell It, If It's Just A Little..."

  • censoredcreampieamateurREXDredmanji groupREXD-352REXD352rexd00352
    • 2021-03-06
    119 min

    [ATID-455]NTR - When A Female Superior Fucked By Her Underling Takes Her Revenge Yuri Honma - Riho Fujimori

  • really riho fujimori censoredATIDattackerseitaro hagaein madATID-455ATID455atid00455
    • 2021-03-10
    105 min

    475KCK-010 Kachikuotokonoko 10 Remodeled female body with multiple acme disease

  • amateur censoredanalamateurkckkck-010kck010475kck-010
    • 2021-03-12
    41 min

    [CLO-137]Coercion Secretary. Target: Ayumi - Ayumi Shinoda

  • ayumi shinoda censoredCLOchobitchchovicCLO-137CLO137h-1435clo00137
    • 2021-03-22
    248 min

    [NSPS-980]Forbidden Secret Story! Family Fun - Best Edition

  • miori fujisawa good miki ryoko izawa miki yoshii censoredmature womandramaNSPSnagae stylehidetora moriNSPS-980NSPS980nsps00980
    • 2021-04-03
    117 min

    [BKD-260]Stepmother/Stepson Fucking (The Nasu Sabi River Road) Yurika Aoi

  • yurika censoredmature womansingle workBKDrubyhiroyuki kimuratobijiBKD-260BKD260bkd00260
    • 2021-04-14
    150 min

    [BLK-493]She Licks And Sucks So Good It's Nasty - Sluts We Found In A Back Alley And Brought To A Love Hotel For An All-Day Blowjob-A-Thon

  • censoredcreampieblowjobBLKkira kirakira kira black galBLK-493BLK493blk00493
    • 2021-04-24
    57 min

    FC2PPV 1784832 Testicle Massage ＃ 12 Kotomi Sakuraba [Tokyo Hands @ Men’s Esthetics]

  • amateur uncensoredfc2
    • 2021-05-01
    128 min

    [DKWT-010]I Picked Up A Beautiful Unsatisfied Housewife And Showed Her My Hard Dick And She Let Me Cum Inside Her: The Raw Footage vol. 1

  • censoredcreampieamateurDKWToffice k syoung wife.communicationDKWT-010DKWT01036dkwt00010
    • 2021-05-07
    60 min

    230OREC-757 Melo

  • amateur censoredcreampieamateurorecorec-757orec757230orec-757
    • 2021-05-07
    66 min

    230OREC-758 Hakucho

  • amateur censoredcreampiebig titsorecorec-758orec758230orec-758
    • 2021-05-11
    64 min

    Caribbeancom 051121-001 Sex practice with my sister-in-law who wants to work in luxury spa Rino Sakuragi

  • rino sakuragi uncensoredcreampiecaribbeancom
    • 2021-05-11
    30 min

    FC2PPV 1812134 [Infiltration Documentary] Roppongi Men’s Esthetics / Oil Handjob Hidden Shooting / Demon Nipple Attack Course [Kurashina Yo Aoi (24 years old) 2nd]

  • amateur uncensoredfc2
    • 2021-05-23
    118 min

    420POW-003 Osuzu [Talent activity / Big breasts Lori / Big butt / Beautiful skin / Climax] The impeccable dirty body is praised by users! A beautiful girl with huge breasts who has been scouted in a local city and is currently active as a talent! Sha

  • amateur censoredbig titsuniformpowpow-003pow003420pow-003
    • 2021-06-01
    216 min

    [KUSE-015]This Anal Virgin Is A Real-Life College Girl Who Is Getting Her First Anal Fuck While Dribbling Anal Juices And Straining Herself Through Orgasmic Pleasure Sara Kagami (21 Years Old) 3-Hole Sex A Massive Enema Consecutive A-to-M (Get Your N

  • kagami sara censoredsingle workKUSEsod createyuukanjoyuu no kuse ga sugoiKUSE-015KUSE0151kuse00015
    • 2021-06-06
    16 min

    10musume 060621_01 Secret Pussy Collection: Hiroko Akita

  • amateur uncensored10musume
    • 2021-06-11
    120 min

    [IPX-670]I Hate My Boss And Would Rather Die Than Fuck Him, But During Our Business Trip, To My Surprise, We Were Booked Into The Same Room At The Hot Spring Resort Inn ... And This Disgusting, Horny Old Man Made Me Cum, Over And Over Again. Rio Kuri

  • rio kuriyama censoredbig titssingle workIPXidea pocketdishIPX-670IPX670ipx00670
    • 2021-06-17
    120 min

    [SYKH-029]Soft, Pillowy, H-Cup - Huge Tits Lolita Wife With A Hairy Pussy Corrupted By Creampie Sex! Yume, Age 24

  • censoredbig titsbukkakeSYKHleisurely missus emmanuelleSYKH-029SYKH029sykh00029
    • 2021-06-24
    73 min

    326HGP-026 [Tall / G Cup Big Breasts / Creampie] World-class 177cm tall slender beauty OL! Very long inseam for overseas model class! Drunk guck gaku big cum with raw insertion gun thrust that attacks sleep! !!

  • amateur censoredbig titsamateurhgphgp-026hgp026326hgp-026
    • 2021-06-25
    238 min

    [BMW-236]Super Squirting Pussy! Convulsing And Trembling Orgasms From Pumping Piston Fuck Best!

  • bud julia censoredcreampiebeautiful girlBMWwanz factorywanzBMW-236BMW236bmw00236
    • 2021-06-29
    140 min

    [SDAB-185]It's 7 Hours Remaining Until Curfew Time, And This Beautiful Girl With An Exquisite Body Is Surrounded By 9 Creepy Crawly Dirty Old Man Cocks, Relentlessly Creeping On Her In A Long Day Of G*******g Sex Saya Kuriyama

  • saya kuriyama censoredbeautiful girlsingle workSDABsod createharii ichiseishun jidaiSDAB-185SDAB1851sdab00185
    • 2021-07-03
    125 min

    [KTB-046]Office Girls Get Groped - Officer Workers Who Get Felt Up And Find Themselves Liking It Edition -

  • censoredbig titsbukkakeKTBkahanshin tigers mousouzokukahanshin tigersKTB-046KTB046ktb00046
    • 2021-07-13
    60 min

    511SDK-012 [Personal shooting] Gonzo date secretly to a frustrated nympho beauty husband who masturbates in the passenger seat

  • amateur censoredamateursdksdk-012sdk012511sdk-012
    • 2021-07-17
    126 min

    [MISM-206]Perfect Masochist 20-year-old Girl Loves To Get Fucked So Crazy Hard That She Cums Out Of Control! Yuri Omori.

  • yuri omori censoredcreampiebig titsMISMm girls labshura jinMISM-206MISM206mism00206
    • 2021-07-23
    91 min

    [sqb-111]ゆきの

  • amateur censoredbig titsamateursqbsqb-111sqb111sqb-111
    • 2021-07-31
    194 min

    [SORA-325]An Exhibitionist And Lolita Enthusiast Turns Into A Slut Outdoors. Urara Kanon.

  • hanaoto urara censoredcreampiecosplaySORAyama to soradenchuuSORA-325SORA325sora00325
    • 2021-08-14
    120 min

    [KSBJ-151]A Son"s Wife Was A Slut By Nature... Michiru Kujou.

  • kujo michiru censoredcreampieslutKSBJksb kikaku emmanuellesakura ninKSBJ-151KSBJ151ksbj00151
    • 2021-09-10
    155 min

    [IPX-732](No Panties) And (Deep Kiss) Losing It To Her Temptations, We Fuck For An Entire Day Over And Over Even Though I Have Work. "Minami" And Her Amazing Love Minami Aizawa

  • minami aizawa censoredblowjobsingle workIPXidea pocketinaballdishIPX-732IPX732ipx00732
    • 2021-09-11
    211 min

    [BAZX-305]Full POV x Total Domain: Beautiful Y********l In Knee High Uniform vol. 001

  • censoredbeautiful girlBAZXk m producetodobazookaBAZX-305BAZX305bazx00305
    • 2021-10-08
    95 min

    FC2PPV 2314275 [Individual Shooting 57] Appearance 20 Years Old Black Hair Neat And Clean Streak Pie Bread ③ Cleaning Blowjob After Reinjecting With A Beaker From Vaginal Cum Shot Many Times

  • amateur uncensoredfc2
    • 2021-10-23
    241 min

    [SCOP-743]Legendary Hole In The Wall!! Crazy Service Investigation Highlights

  • censoredcreampieamateurSCOPscooptaro kSCOP-743SCOP743scop00743
    • 2021-10-30
    118 min

    [XVSR-621]Ichika Matsumoto Binaural Sex Film! Ichika Matsumoto

  • ichika matsumoto censoredcreampiebeautiful girlXVSRmax ayoshida ikuzoucalenXVSR-621XVSR621xvsr00621
    • 2021-11-05
    187 min

    [HUNBL-068]Autoerotic Asphyxiophilia

  • censoredcreampiedeepthroatHUNBLhuntergangurionhhh groupHUNBL-068HUNBL068hunbl00068
    • 2021-11-05
    179 min

    [IPX-759]When My Girlfriend Was Out of Town For 2 Days. Addicted to Matchless Creampie Sex With Soapland Queen Momo-san Momo Sakura

  • sakura sky momo censoredcreampiebig titsIPXidea pocketusapyontissueIPX-759IPX759ipx00759
    • 2021-11-06
    145 min

    [SE-201]Good Morning C*cks! The Return Of The Amateur Hooker Creampie A Real-Life College Girl! Our Beloved, Beloved Sara Kagami A Sadistic, Silky Smooth (I Have A Shaved Pussy ...) Shitty Lady Boss Was Such A Super Selfish Bitch When It Came to Sex

  • censoredSEpuramutoukousha akirashirouto only plumSE-201SE20184se00201
    • 2021-11-26
    103 min

    [YST-259]I Must Be A Pervert, Dripping Pussy Juice While Father-In-Law Treats Me Like His Mouth Cunt. Kanna Hirai

  • shiori hirai censoredcreampiedeepthroatYSTkoyachoYST-259YST259540yst00259
    • 2021-11-26
    137 min

    [ECB-149]I"ll Lend You The Key To M Otoko-kun"s Apartment. Shiina Uno

  • uno sakina abe sakina censoredslutsingle workECBwaap entertainmentkurumi ichinosecobra warpECB-149ECB1492ecb00149



    • Japan xxx, japanese adult videos, japani sexy, Japanese Adult Movies, JAV censored, Japanese tube, Japanese sex online