documentary censored high vision creampie javcensored




FC2NGODCAWDJUFESHKDMVSDAWDHDKASQTEMARANATRKBISTARSNACXGVHHZGDDASDMIAAAVSAPPPDMIDE

2020-09-05
119 min

[SSNI-859]This Colossal Tits Female Employee Was With Her Orgasmic Boss Sharing A Hotel Room During Their Business Trip... And She Spent The Night Get Fucked From Morning Until Evening Shion Yumi

  • evening beauty censoredbig titssingle workSSNIs1 no 1 styleamazing meatSSNI-859SSNI859ssni00859
    • 2020-09-24
    55 min

    [MASE-001]配信限定 四十路マダム 佐倉里緒奈

  • sakura riona censoredbig titsblowjobMASEcrystal imagetakeshi matsudairamadam maniac plusMASE-001MASE00149mase00001
    • 2020-09-26
    158 min

    [JUNY-026]Busty Married MILF In Glasses With A Wild Sub Side! Fantasies And Masturbation Aren't Enough To Keep Her Raging Libido In Check, So She Made A Porno Yukino Azuma

  • yukino azuma censoredbig titssingle workJUNYfitchnikuyokuJUNY-026JUNY026juny00026
    • 2020-09-26
    47 min

    [HHKL-067]"I Gotta Peel Back And Wash Your Penis Skin Properly!" My Much Older Step Sister Always Treats Me Like A C***d, And She Tries To Peel Back My Foreskin And Clean It Properly! Glamorous Big Tits Older Step Sister

  • censoredbig titshandjobHHKLhuntermorikihhh groupHHKL-067HHKL067hhkl00067
    • 2020-10-03
    169 min

    [JUL-336]24 Hours A Day, This Stepmom Is Luring Her Son-In-Law To Temptation Because She Wants His Big Cock So Badly, She Just Can't Help Herself Ayumi Miura

  • ayumi miura censoredbig titsmature womanJULmadonnakogoro kindaichiJUL-336JUL336jul00336
    • 2020-10-10
    120 min

    [MIAA-330]An Orgasmic Genius! The Girls At This Titty Fuck Rejuvenation Massage Parlor Will Rub Their Titties Up Against You An Amazing Titty Technique Consecutive Creampie Full Course Special Rika Tsubaki

  • tsubaki rika censoredcreampiebig titsMIAAmoodyzgoemoneveryone s porn starMIAA-330MIAA330miaa00330
    • 2020-10-17
    119 min

    [SSNI-903]My Boss Was Away On A Business Trip For Three Days, So I Creampied His Wife Again And Again! With Miu Nakamura

  • miu nakamura censoredcreampiesingle workSSNIs1 no 1 stylezaku araiSSNI-903SSNI903ssni00903
    • 2020-11-05
    66 min

    FC2PPV 1559080 [Complete amateur 92] Mirai 19 years old Part 5, I tried to bring a small pure beautiful girl to the SM hotel.

  • amateur uncensoredfc2
    • 2020-11-17
    51 min

    330PER-338 Saya

  • amateur censoredamateurslutperper-338per338330per-338
    • 2020-12-10
    220 min

    [SVDVD-829]One-Way Mirror Car - Hard-Boiled We Told Hot A Gorgeous Married Woman In Black Pantyhose "If You Stay Standing For The Whole Time Period You'll Win 1,000,000 Yen" Then Subjected Her To A Vibrator That Stimulates Her G-Spot 19 T

  • censoredcreampiesquirtingSVDVDsadistic villagesushi yokubomagic mirror number sadistic villageSVDVD-829SVDVD8291svdvd00829
    • 2020-12-17
    718 min

    [OFJE-290]Arina Hashimoto - 127 Fucks, 12 Hours, All 47 S1 Titles All Real Fucks BEST Collection

  • there is hashimoto censoredsquirtingblowjobOFJEs1 no 1 styleOFJE-290OFJE290ofje00290
    • 2020-12-20
    136 min

    [JUL-412]I Had To Leave My Lecherous Old Man And My Weak-Willed Wife For A 2-Night, 3-Day Business Trip. Sure Hope Nothing Happened... Natsu Tojo

  • natsu tojo censoredmature womansingle workJULmadonnamametaro mamezawaJUL-412JUL412jul00412
    • 2020-12-31
    149 min

    [HUNBL-027]A Domestic Orgy - We Were Dominated By Our Stepfather -

  • censoredcreampieHUNBLhunteraldebaranhhh groupHUNBL-027HUNBL027hunbl00027
    • 2021-01-01
    243 min

    [NACX-070]Legendary Beautiful Mature Women, 12 People, BEST

  • hisae yabe yumi anno censoredbig titsNACXplanet plusnanakuruNACX-070NACX070h-237nacx00070
    • 2021-01-04
    87 min

    [sd-010]はるかちゃん

  • amateur censoreduniformamateursdsd-010sd010sd-010
    • 2021-01-13
    44 min

    302GERK-342 Sarina

  • amateur censoredcreampieamateurgerkgerk-342gerk342gerk-342
    • 2021-01-24
    100 min

    [NSPS-962]Posted True Stories: My Wife Got G*******ged 13 - Tragedy At A Campsite - Hijiri Maihara

  • kiyoshi maihara censoredmature womansingle workNSPSnagae stylenagaeNSPS-962NSPS962nsps00962
    • 2021-02-03
    135 min

    [GVH-189]New Married Women Exhibition Circle - Mizuki Yayoi/Aya Mamiya

  • mizuki yayoi aya mamiya censoredcreampieGVHglory questhajime kimuraGVH-189GVH18913gvh00189
    • 2021-02-06
    31 min

    FC2PPV 1675445 Limited to 3 days [Individual] Beautiful wife of a spender. She can not repay and is taken to the room and vaginal cum shot in her raw vagina

  • amateur uncensoredfc2
    • 2021-02-11
    135 min

    [SW-756]I Like Older Men. My Friend's Little Sister Was Totally My Type, And She Was The Kind Of Sch**lgirl Who Loved To Lure Men To Temptation! She Got Me Hot And Hard With Her Total Domain Of Knee-High Socks, And Tempted Me With Her Sweet Voice

  • kagami sara censoredschoolgirlsingle workSWswitchSW-756SW7561sw00756
    • 2021-02-12
    99 min

    [ZOZO-042]Miss Hikari Yuino

  • censoredcreampiebig titsZOZOsadie willenauZOZO-042ZOZO0421zozo00042
    • 2021-03-08
    52 min

    492MERC-242 The teacher has already quit …

  • amateur censoredbig titsuniformmercmerc-242merc242492merc-242
    • 2021-03-11
    15 min

    HEYZO 2476 A Titty Fuck with Reiko – Reiko Mizuhara

  • reiko mizuhara uncensoredhandjobcumshotheyzo
    • 2021-03-18
    220 min

    [HUNTA-971]"Please Untie Me ... This Is So Embarrassing" I Tied Up My C***dhood Friend In Special Knots That Are Impossible To Untie By Herself, And I Put Her In The Paradise Lock Position, And When I Saw Her Thrusting Her Super Erotic Ass Ou

  • censoredschoolgirlHUNTAhuntergorilla butahhh groupHUNTA-971HUNTA971hunta00971
    • 2021-03-18
    64 min

    10musume 031821_01 The School Uniform: I’ll grant you whatever you want today Sumire Kamogawa

  • amateur uncensored10musume
    • 2021-03-19
    150 min

    [SSIS-023]Amateur No. 1 Style Uta Hayano Porn Debut

  • hayano uta censoredbig titsbeautiful girlSSISs1 no 1 stylemon cSSIS-023SSIS023ssis00023
    • 2021-03-27
    58 min

    292MY-419 Rikako Okamoto

  • amateur censoredmarried womanamateurmymy-419my419292my-419
    • 2021-03-30
    41 min

    292MY-438 Yu Matsushima 2

  • amateur censoredcreampiebig titsmymy-438my438292my-438
    • 2021-04-13
    119 min

    [DPMX-015]Celebitch! The Temptation Of Compltely Clothes On Sex Ren Usui

  • usui ren censoredbig titssingle workDPMXavs collector sdopamixavscollector sDPMX-015DPMX015dpmx00015
    • 2021-05-07
    112 min

    [IENF-140]I'm A Sorry Loser So When My S********l Little Sister Made Me Promise To Only Grind Up Against Her Pussy, We Both Started To Feel So Nice, Her Pussy Was Dripping Wet And Read! And My Dick Just Slipped Right In! "What!？ Are You Insid

  • momose asuka natural kanon censoredcreampieschoolgirlIENFienergyienfIENF-140IENF1401ienf00140
    • 2021-06-12
    135 min

    [CEAD-343]I Am A Nasty Masturbator, Drowning In Pleasure 15 Hikari Sena

  • hikari sena censoredbig titsmature womanCEADceleb no tomoCEAD-343CEAD343cead00343
    • 2021-06-16
    60 min

    Caribbeancom 061621-001 Quick Shooting: The Best of Ciel Hiiragi

  • ciel hiiragi uncensoredcreampiehandjobcaribbeancom
    • 2021-06-19
    70 min

    200GANA-2510 Seriously Nampa, first shot. 1650 "Longing for City Girl …" Bring the up-and-coming man who has just come to Tokyo to the hotel! A beautiful girl who has been baptized in the city leaks the tide and her breath constantly tre

  • amateur censoredsquirtingamateurganagana-2510gana2510200gana-2510
    • 2021-06-22
    73 min

    300MAAN-667 [Baby Face x Big Breasts / Brain Iki x Vagina Iki / Massive Squirting & Cum Shrimp Warp] H Cup De M Daughter Brought Up By Nature! Izakaya clerk / no hand masturbation who came to have sex from Yamanashi for 3 hours one way! ？？ Toro sq

  • amateur censoredbig titssquirtingmaanmaan-667maan667300maan-667
    • 2021-07-14
    153 min

    [HUNBL-053]Before I Knew It, My Room Had Become A Hangout Place For Runaway Barely Legal Babes! They Never Refuse Sex, And No Matter How Many Times I Cum Inside Them, They Never Complain. I Wonder How It Came To This ...

  • censoredcreampieschoolgirlHUNBLhunterbajiohhh groupHUNBL-053HUNBL053hunbl00053
    • 2021-07-18
    46 min

    FC2PPV 1928021 Cosplay 18 Years Old. Unknowingly I Removed The Rubber And Made A Vaginal Cum Shot

  • amateur uncensoredfc2
    • 2021-07-22
    240 min

    [BMW-238]Continuing Fucking Her After Creampie! 50 Shots Of Pregnancy-assured Sex Into a Creampie Shake.

  • julia bud censoredcreampiebeautiful girlBMWones factorywanzBMW-238BMW238bmw00238
    • 2021-08-02
    31 min

    FC2PPV 1951099 First Shot! !! Limited Number! Creampie Twice To A Nasty Neat And Clean Beauty With Outstanding Sensitivity Who Cums With Bikunbikun! !! (Feature Film)

  • amateur uncensoredfc2
    • 2021-08-26
    134 min

    [DANDY-777]Instant Gratification! A Little Devil Girl Who Can Make Any Troubled Man Cum By Sucking Him So Hard That He Gets A Hickey 5 Seconds After Entering The Room Ichika Matsumoto Aged 21

  • ichika matsumoto censoredcreampieslutDANDYdandymomoiro kenkyoDANDY-777DANDY7771dandy00777
    • 2021-09-02
    247 min

    [CUBEX-006]Absolute Raw Fucking For Getting Off Collection 6. Steaming Hot Amateur Big Tits Gravure Wife Pickup Adventures, 4 Hours

  • censoredcreampiebig titsCUBEXcubecube cubeCUBEX-006CUBEX006h-1593cubex00006
    • 2021-09-07
    218 min

    [STARS-412]美装「どのコスプレで抜きたい？」 MINAMO 超大型新人

  • minamo censoreduniformcosplaySTARSsod createeasy matsumotosod starSTARS-412STARS4121stars00412
    • 2021-10-18
    75 min

    530DG-015 ＃ 03 Female College Students Who Are Abandoned On The Emergency Stairs Of The Building At The New Welcome Party And Fall Asleep

  • amateur censoredcreampiebig titsdgdg-015dg015530dg-015
    • 2021-10-22
    124 min

    [JUL-752]After The Grad Ceremony... I Have A Special Present For (Not) My Grown-Ass Stepson. Marina Shiraishi

  • rena shiraishi censoredbig titsmature womanJULmadonnahimurokkuJUL-752JUL752jul00752
    • 2021-10-30
    125 min

    [GVH-311]Cunt Device Bondage, No. XXIII Tied Up in Iron. Playing With the Cunt. Rin Miyazaki

  • miyazaki rin censoredcreampiedeepthroatGVHglory questGVH-311GVH311gvh00311
    • 2021-11-03
    66 min

    FC2PPV 2400815 * Limited [Titty Fuck Pinching] The Long-Sought God Body Advent! Super Soft Milk Hcup Half Instagrammer Is Defeated And Fucking From The Appearance Ok! [First-Time Limited Privilege: Lotion Stool Fucking Pinch] [cen]

  • amateur uncensoredfc2
    • 2021-11-06
    153 min

    [SABA-732]Sharing A Hotel Room With My Coworker After We Went Out And Missed The Last Train... She Seemed So Unguarded, I Couldn"t Resist Her... vol. 013

  • censoredcreampieamateurSABAs kyuu shiroutotodoSABA-732SABA732saba00732
    • 2021-11-12
    166 min

    [BLK-534]Convenient Free Pussy! Fucking Raw Till Morning With A Horny Bitch Who Loves Older Men 09

  • censoredcreampiesquirtingBLKkira kiraBLK-534BLK534blk00534
    • 2021-12-10
    127 min

    [BBAN-351]Two Cute Girls Kissing And Drooling Over Each Other, W Lesbian Ban, Yuzu Shirakawa, Rin Miyazaki.

  • yuzu shirakawa miyazaki rin censoredlesbianbeautiful girlBBANbibianBBAN-351BBAN351bban00351
    • 2022-01-01
    61 min

    [HEYZO-2694]Hina Hodaka Get Laid With A Baby-faced Beautiful Girl At Premium Soapland

  • hina hodaka uncensoredblowjobhandjobheyzo
    • 2022-01-08
    151 min

    [CHRV-147]See Her Massive Tits Through Her Soaking Wet School Uniform! Adorable Girl With Soft H-Cup Breasts Dotes On You!

  • censoredcreampiebig titsCHRVcherry revolution daydream tribecherry s reboCHRV-147CHRV147chrv00147
    • 2022-01-21
    79 min

    FC2PPV 2610813 [3 Days Limited 2480 → 1480] [Sanctions] Fucking Cheeky Beauty Busty Daddy A Live Woman Is Brought To The Hotel And Two Men Are Contacted And Played With Vaginal Cum Shot.

  • amateur uncensoredfc2
    • 2022-02-10
    21 min

    [HEYZO-2715]Honoka Orihara A Titty Fuck with Honoka

  • honoka orihara uncensoredheyzo
    • 2022-02-11
    94 min

    FC2PPV 2651169 Conceived Contract! With A Delicate Body, You Can Make A Vaginal Cum Shot To Serika-Chan, Insert It Again And Stir The Sperm And Make A Vaginal Cum Shot Again! [Discount Until 2/14]

  • amateur uncensoredfc2
    • 2022-02-25
    102 min

    [YSN-569]The Scent Of A Wife Whose Flesh Has Ripened Early. Honami Akagi

  • honami akagi censoredcreampiesingle workYSNnonYSN-569YSN569h-127ysn00569
    • 2022-03-04
    120 min

    [IPX-826]Like A Substitute Flesh Urinal! 10 Days Of Impregnation Confinement With Dirty Old Man Who Never Stops Ejaculating. Miu Shiromine

  • shiramine miu censoredcreampiesquirtingIPXidea pocketdishIPX-826IPX826ipx00826
    • 2022-03-08
    66 min

    [FGMT-008]A Big Tits Shaved Pussy Beautiful Girl With A Doll Faith Is Getting Deep And Rich Plays Until She Descends Into Orgasmic Pleasure Aya Kobayashi

  • amateur censoredbeautiful girlFGMTorustak softFGMT-008FGMT008



    • Japan xxx, japanese adult videos, japani sexy, Japanese Adult Movies, JAV censored, Japanese tube, Japanese sex online