creampie jav high vision amateur javcensored




FC2GVHNACRGMEMDASDSANRBDWAAADTTKSBJABWDASDPPPDAVSAMVSDADNMEYDMILKSPRDJUFELULU

2020-10-09
239 min

[SOUD-010]An Orgy Sex Party Thrown By Amateur Beautiful Girl Babes! A Furious 4-Hour Special Featuring Massive Loads Of Semen, Continuously Pumped Into Hungry Pussies!!

  • censoredcreampieSOUDprestigebest fuckingSOUD-010SOUD010118soud00010
    • 2020-10-20
    91 min

    300MIUM-649 [Cum & Creampie] A talented secretary swallows sperm for business execution. Even during the interview, the president’s luxury car will attack without hesitation, confronting the sexually unreasonable problem with an erotic ass s

  • amateur censoredcreampieamateurmiummium-649mium649300mium-649
    • 2020-10-23
    115 min

    [VDD-166]Female Teacher In... (Coercion Suite) - Yuria Yoshine

  • yoshine yuria censoredbig titsdeepthroatVDDdream tickettakuanvivid dream ticketVDD-166VDD16624vdd00166
    • 2020-10-30
    16 min

    10musume 103020_01 Secret Pussy Collection: Mayumi Kato

  • amateur uncensored10musume
    • 2020-10-30
    50 min

    [MASE-005][Delivery Only] Married Woman's Adultery Kyoko Maki

  • maki kyoko censoredcreampiebig titsMASEcrystal picturemadam maniac plusMASE-005MASE00549mase00005
    • 2020-11-10
    44 min

    FC2PPV 1564701 Personal shooting] A neat and active female college student, 20 years old, challenges her first shooting. Screaming with electric massage machine and nipple licking! Sensitive female college student meat jar with uncle’s uncleR

  • amateur uncensoredfc2
    • 2020-11-22
    161 min

    [CJOD-269]Oral Sex Gal Massage Parlor "I'll Lick And Suck Your Cock, Balls, And Ass Until They're Swollen" Hina Nanami

  • hina nanami hina nanase censoredblowjobsingle workCJODchijo heavenkogoro kindaichiCJOD-269CJOD269cjod00269
    • 2020-12-26
    147 min

    [JUFE-242]A Video Record Of Warped Love Breaking In And Domesticating A Pure And Simple Female S*****t For 20 Days Until She Breaks Down Mitsuha Higuchi

  • mitsuha higuchi censoredschoolgirlblowjobJUFEfitchJUFE-242JUFE242jufe00242
    • 2021-01-01

    FC2PPV 1628417 * Ends in 3 days [Appearance] Prefectural Commerce Department ① Staying in a simple little girl with one experience and vaginal cum shot

  • amateur uncensoredfc2
    • 2021-01-07
    479 min

    [CADV-798]Crystal Films 35th Anniversary - Wife Collection - 100 Girls, 8-Hour Timeless Collector's Edition

  • yui hatano really censoredcreampiebig titsCADVcrystal picturecrystal exCADV-798CADV79849cadv00798
    • 2021-01-08
    62 min

    Pacopacomama 010821_416 Ayumi Tsuji

  • ayumi tsuji uncensoredcreampiebig titspacopacomama
    • 2021-01-09
    157 min

    [IPX-591]Let's Hurry Up, Get Naked, And Fuck, Okay？" Whether A****p Or Awake, She's Always French Kissing A Virtual Fuck Fest Love Life Together A Lovey-Dovey Couple Iyona Fujii

  • iyo fujii censoredblowjobbeautiful girlIPXidea pocketkyoseidishIPX-591IPX591ipx00591
    • 2021-02-05
    63 min

    SIRO-4413 [First shot] [Sunburn marks left on the young body] [To the extent that serious juice overflows ..] A 19-year-old female college student who is ashamed of her small breasts. If you start leaking a lascivious voice to the blame of a sticky m

  • amateur censoredamateursirosiro-4413siro4413siro-4413
    • 2021-02-06
    42 min

    C0930 hitozuma1347 Sonomi Hijiri 27years old

  • amateur uncensoredc0930
    • 2021-02-11
    146 min

    [SPRD-1376]This World Exists For Men And Women Only A Dirty Old Man Who Likes To Lick And A Horny Bride Nanako Takamiya

  • nanako takamiya censoredsingle workSPRDtakara eizokon oriharualeddinSPRD-1376SPRD137618sprd01376
    • 2021-02-21
    122 min

    [DASD-818]The Golden Shower Domain This Sch**lgirl Was Receiving Breaking In Piss Training By A Teacher With Abnormal Sexual Hangups And Now She's Dribbling Her Holy Waters Down Her Crystal Pure Thighs Mao Watanabe

  • mao watanabe censoredcreampiesquirtingDASDdassDASD-818DASD818dasd00818
    • 2021-02-24
    83 min

    453SSAN-017 Nozomi

  • amateur censoredbig titsamateurssanssan-017ssan017453ssan-017
    • 2021-03-12
    80 min

    453SSAN-020 Midnight Sex With Ai-san.

  • amateur censoredbig titsamateurssanssan-020ssan020453ssan-020
    • 2021-03-26
    244 min

    [MGT-139]Will You Charge Me Up？ vol. 01

  • censoredcreampiebig titsMGTprestigemegatraMGT-139MGT139118mgt00139
    • 2021-04-08
    112 min

    [SPRD-1397]Since The Day I Slept Next To My Stepmom... Rieko Hiraoka

  • rieko hiraoka censoredmature womansingle workSPRDtakara eizokyuta tukumoaleddinSPRD-1397SPRD139718sprd01397
    • 2021-04-12
    66 min

    FC2PPV 1766536 [Limited to 100 pieces 1000pt off] Serious 21 years old ❤️ Big labia minora ❤️ Minimal pussy ❤️ The second time that a big meat stick old man continuously squeezes a narrow vagina ❤️ Creampie boiling sperm in a melting pussy ❤️

  • amateur uncensoredfc2
    • 2021-04-21
    35 min

    FC2PPV 1780423 [Uncensored] I got acquainted with her again ♥ I was a quiet child, but I was sloppy with man juice ♥ [Personal shooting]

  • amateur uncensoredfc2
    • 2021-04-23
    59 min

    FC2PPV 1783989 [Actual record] G-cup 18-year-old house I met in Kabukicho, Shinjuku ● I quarreled with my daughter and parents and stayed at a manga cafe

  • amateur uncensoredfc2
    • 2021-05-14
    120 min

    [OKSN-335]A New Discovery! What A Small Waist! Such Colossal Tits! This Seriously Erotic And Beautiful Girl Has Exquisite Style To Spare, And Will Light The Furious Fires Of Her Smoldering Lust An Afternoon Love Affair

  • censoredbig titshandjobOKSNabc mousouzokuokasan.comOKSN-335OKSN335oksn00335
    • 2021-05-16
    139 min

    [MXGS-1184]Intertwining Body Fluids ~ Hot Smothering Kisses Mutually Seeking Up Close And Personal Raw Sex Hono Wakamiya

  • honoka wakamiya censoredbeautiful girlsingle workMXGSmaxingMXGS-1184MXGS1184h-068mxgs01184
    • 2021-06-05
    56 min

    C0930 gol0166 Sumiko Terai 29years old

  • amateur uncensoredc0930
    • 2021-06-15
    55 min

    481SACZ-036 Sachiyo 2

  • amateur censoredamateurmature womansaczsacz-036sacz036481sacz-036
    • 2021-06-24
    210 min

    [SW-782]My Female Colleagues Seduce Me By Showing Off Their Panties Through Their Black Pantyhose In The Office And On Business Trips - Do You Mind If I Rip Your Stockings And Stick My Dick In？

  • censoredSWswitchyocchanswitch hibinoSW-782SW7821sw00782
    • 2021-06-26
    151 min

    [LULU-077]Her Husband Was Out, So It Was Just The Two Of Us - I Couldn't Resist My Step-Aunt's Big Booty While She Was Cleaning, And Ended Up Pounding It Right To A Creampie. Ai Mukai

  • ai mukai censoredcreampiesingle workLULUlunaticsluminaxLULU-077LULU077lulu00077
    • 2021-07-10
    184 min

    [CEMD-030]Invitation To The Debauched Pleasure Hell Where 3 Sadistic Sisters Have Fallen! A Pleasure Hell Trap That Is Easy to Enter But Impossible To Leave!

  • aya shiomi yuri sasahara censoredsquirtingmature womanCEMDceleb no tomoCEMD-030CEMD030cemd00030
    • 2021-07-15
    60 min

    C0930 ki210715 Ayako Matsuzaki 49years old

  • amateur uncensoredc0930
    • 2021-07-20
    99 min

    [SPZ-1108]Where Won't You Fuck？! Refreshing Swimsuit Girl In A Private Room

  • censoredSPZstar paradisestar paradiesSPZ-1108SPZ1108h-254spz01108
    • 2021-07-23
    116 min

    [XVSR-606]Dense - Super Beautiful Girl (Himari Kinoshita) Has True Loving Raw Creampie Sex - Himari Kinoshita

  • himari kinoshita himari hanazawa censoredcreampiebeautiful girlXVSRmax ashanty yazawacalenXVSR-606XVSR606xvsr00606
    • 2021-08-06
    156 min

    [EBOD-849]G-Cup Tits So Big You Can Appreciate Them Under Her Uniform - This Bright, Smiling Sportscaster Has Seduced Even The Most Famous Athletes - Enjoy Her Porn Debut Reona Tomiyasu

  • takehiro tomiyasu censoredbig titssingle workEBODe bodymonEBOD-849EBOD849ebod00849
    • 2021-08-15
    115 min

    [083PPP-2213]サオあり美人ニューハーフSEX10連発！女をハメて男に掘られてチンポもアナルもフル稼働(4)

  • amateur censoredamateurpppppp-2213ppp2213083ppp-2213
    • 2021-09-02
    71 min

    [REBD-584]Remu4 Last Paradise. Remu Suzumori

  • suzumori remu censoredbig titssingle workREBDrebeccazack araiREBD-584REBD584h-346rebd00584
    • 2021-09-24
    150 min

    [HUNBL-062]- Young Wife Babes Who Gave Up And Let Themselves Be Fucked - This Young Wife Stopped Resisting As She Got Fucked In Her Own House One Afternoon, And Allowed Herself To Be Toyed With In An Endless Cycle Of Deep Throat Dick Sucking And Crea

  • censoredcreampiedeepthroatHUNBLhuntergangurionhhh groupHUNBL-062HUNBL062hunbl00062
    • 2021-10-01
    148 min

    [MIMK-096]I Met A Demonic Salt-faced Girl With Huge Tits And Insane Sex Drive At A Party Live Action Of Popular CG Comic About Fucking All The Plump Girls! Hatsu Ai Nenne

  • first love censoredcreampiebig titsMIMKmoodyzkubo stylemankitsuMIMK-096MIMK096mimk00096
    • 2021-10-08
    120 min

    [IPX-739]24 Hour Oral Ejaculations Made Possible Through A Mobile Nurse Call System! Nympho Nurses Who Totally Love To Instantly Start Sucking Ema Futaba

  • futaba emma censoredblowjobbeautiful girlIPXidea pocketakai suiseitissueIPX-739IPX739ipx00739
    • 2021-10-22
    118 min

    [JUL-754]I Could Never Tell My Wife, No Matter What, That I Had A Pregnancy Fetish For My Stepmom ... I Went On A 2-Day, 1-Night Hot Spring Resort Vacation, Lost My Mind, And Went On A Creampie Fuck Fest. Minori Hatsune

  • hatsune minori censoredbig titsmature womanJULmadonnaunicorn fukudaJUL-754JUL754jul00754
    • 2021-10-24
    63 min

    413INST-177 [Fortune-Telling Nampa 3] Big Breasts Cow Boobs ♀ Big Breasts Glasses Ol & Abdominal Muscle Bakibaki Ol Muscle Man’s Seeding Pistons Raging Demon Acme! Creampie Orgy Personal Shooting Of Dirty Juice Injection (Sachiko Hachino Tsub

  • amateur censoredcreampiebig titsinstinst-177inst177413inst-177
    • 2021-11-05
    209 min

    [HUNTB-140]Troublesome Step-sister Is Always Walking Around In Nothing But A Terrible Jersey, But She"s Hot And Mature In This Perfect Knit Dress! Now Her Sexy Body And Figure Just Looks Way Too Good!？

  • censoredcreampiesisterHUNTBhunterkonnyaku kannohhh groupHUNTB-140HUNTB140huntb00140
    • 2021-11-06
    70 min

    H4610 tk0046 Aisa Katsura 20years old

  • amateur uncensoredh4610
    • 2021-11-18
    56 min

    230OREC-940 Miina (Miina Konno)

  • amateur censoredcreampieuniformorecorec-940orec940230orec-940
    • 2021-11-19
    210 min

    [ROYD-073]Slut Friends Cum Together - Hard! Horny Nymphos Devour Your Cock... Minami Hatsukawa Yu Shinoda

  • hatsukawa minami shinoda yu censoredmomROYDroyalmorikihhh groupROYD-073ROYD073royd00073
    • 2021-11-25
    76 min

    200GANA-2593 Seriously Nampa, First Shot. 1720 "Women’s Erotic Theory That Has Been Abroad" It Was Really Erotic When I Gave It To A Woman Who Picked Up The Topic Of Full Throttle! Shaking Beautiful Breasts And Fleshly Ass! While Being S

  • amateur censoredsquirtingamateurganagana-2593gana2593200gana-2593
    • 2021-11-25
    133 min

    [RCTD-434]A Lovey-Dovey Love Lesbians Fight Club Chapter 1 Lesbian Skill Training Edition

  • mao watanabe himari ayase censoredschoolgirllesbianRCTDrocketscarecrowRCTD-434RCTD4341rctd00434
    • 2021-12-05
    73 min

    444KING-058 Akari (Hayami Nana)

  • amateur censoredcreampiesquirtingkingking-058king058444king-058
    • 2021-12-28
    40 min

    H0930 ki211228 Sayuri Mikami 50years old

  • amateur uncensoredh0930
    • 2021-12-31
    161 min

    [JUFE-357]I"ll Show You My Bare Body And Seduce You! My Wife"s Best Friend Is A Female Announcer Who Loves To Nakadashi Nao Yuuri

  • yuuri nao censoredcreampiebig titsJUFEfitchmichiru arashiyamaJUFE-357JUFE357jufe00357
    • 2022-01-01
    54 min

    210AKO-448 AIRI (Airi Sato)

  • amateur censoreduniformschoolgirlakoako-448ako448210ako-448
    • 2022-01-08
    242 min

    [NASH-627]Secret Fakecest With My Stepmother, Who Has A Big Ass. Captivated By Her Chubby Ass... 4 Women. 4 Hours.

  • shota chisato ayukawa rui censoredmature womanNASHpinknadeshikoNASH-627NASH627nash00627
    • 2022-02-03
    92 min

    [REBD-622]Tsubomi, No. 4. Tsubomi, An Old-Style Virtuous Woman At The Water"s Edge.

  • bud censoredsingle workREBDrebeccayuko aonoREBD-622REBD622h-346rebd00622
    • 2022-02-18
    116 min

    [BDSM-077]The Japanese Maso Bitch Series Kyoko Vol.13 Yu Kawakami In A Private Breaking In Video Record

  • yu kawakami morino morino censoredbdsmsingle workBDSMtightkaiBDSM-077BDSM077h-1096bdsm00077
    • 2022-02-19
    243 min

    [UMSO-436]Inserting A Vibrator Into A Girl"s Pussy And Having Fun With Her! 12 Girls.

  • hamazaki mao sena ai censoredcreampieUMSOk m produceumanamiUMSO-436UMSO436umso00436
    • 2022-02-21
    123 min

    241GAREA-544 Hii-Chan (Arisa Haboro)

  • amateur censoredamateurbeautiful girlgareagarea-544garea544241garea-544



    • Japan xxx, japanese adult videos, japani sexy, Japanese Adult Movies, JAV censored, Japanese tube, Japanese sex online