creampie big tits cosplay censored pov




FC2CJODNACXDASDMIDVMEYDMIAAHNDWAAASQTESANEBODABWNACRJULMILKBLKJUFESHKDROYDVEMA

2020-10-23
116 min

[CRDD-004]Teens Only, Raw Creampie Western Back Street Pick Ups 003

  • censoredcreampiebig titsCRDDcrazy walkerCRDD-004CRDD004h-1518crdd00004
    • 2020-11-03
    56 min

    396BIG-088 Karen

  • amateur censoredcreampiesquirtingbigbig-088big088396big-088
    • 2020-11-19
    130 min

    [DMDG-049]Masochist Titties Creampie - Rika Tsubaki

  • tsubaki rika censoredcreampiebig titsDMDGgain corporationDMDG-049DMDG049dmdg00049
    • 2020-11-22
    91 min

    [HND-912]Fresh Graduate Finally Lands Her Dream Job At A Lingerie Maker, But Ends Up Getting Sexually Teased By All Their Other Employees Culminating In Big Creampie G*******g - Miyu Misaki

  • misaki misaki censoredcreampiesingle workHNDhon nakaHND-912HND912hnd00912
    • 2020-11-23
    238 min

    [CEAD-325]Totally Freshly Filmed! A Voluptuous Elder Sister Type With An Erotic Ass Is Wearing Tight Black Pantyhose While Having Sex 2

  • aishin shinkawa natsuki censoredcreampiemature womanCEADceleb no tomoCEAD-325CEAD325cead00325
    • 2020-11-23
    60 min

    FC2PPV 1576023 [Personal shooting] [No] First shot! A girl with a cute smile and a small ass shaved pussy! You can download the main part high-quality ZIP, blowjob and masturbation (48 minutes) as a review privilege

  • amateur uncensoredfc2
    • 2020-11-27
    81 min

    259LUXU-1345 Luxury TV 1332 An influencer who sends out trends on SNS appears for the first time in AV with a tense look! A beautiful woman with elegant standing behavior becomes sensitive as soon as the switch is turned on! The secret part overflows

  • amateur censoredamateurluxuluxu-1345luxu1345259luxu-1345
    • 2020-12-02
    50 min

    Caribbeancom 120220-001 My Girl Cheats With My Father Nami Umisaki

  • nami umisaki uncensoredcreampiecaribbeancom
    • 2020-12-12
    119 min

    [MEYD-643]The Horny MILF At My Part-Time Job Is My Very Own Personal Cum Dumpster Ayaka Mochizuki

  • ayaka mochizuki censoredcreampiesquirtingMEYDtameike goroMEYD-643MEYD643meyd00643
    • 2020-12-20
    115 min

    [HND-930]Busty Female Teacher All Alone With Her Hung S*****t At A Love Hotel... She Only Brought One Condom Because They Were Only Supposed To Fuck Once, But She Had To Have Another Helping Of His Huge Cock And Took His Creampie. Nene Tanaka

  • nene tanaka censoredcreampiebig titsHNDhon nakanaveHND-930HND930hnd00930
    • 2020-12-21
    103 min

    [NSPS-954]An On-The-Scene Report From An Adolescent Stepson And A Naughty Stepmom 3 - I Felt Strangely Jealous While Watching My Stepmom Get Fucked By Another Man - Hibiki Yonezu

  • yonezu hibiki censoredmature womanmomNSPSnagae stylejotaro tomiNSPS-954NSPS954nsps00954
    • 2021-01-01
    52 min

    396BIG-092 Aoi

  • amateur censoredcreampieamateurbigbig-092big092396big-092
    • 2021-01-09
    61 min

    1Pondo 010921_001 Seducing by Flashing Pussy: Momoka Ogawa

  • amateur uncensored1pondo
    • 2021-01-15
    120 min

    [UMSO-365]I Became A Divorcee Single Father When My Wife Ran Out On Me, But Suddenly I'm A Hot Item!？ The Neighborhood Mothers Were Sympathetic Towards Me, And Wanted To Help Out, So I've Been Committing Adultery With Them In The Afternoons v

  • censoredcreampiebig titsUMSOk m produceumanamiUMSO-365UMSO36584umso00365
    • 2021-01-15
    66 min

    [YMDS-015]A Delivery Gal! It's A SK**ls Challenge To See How Many Cum Shots She Can Fire Off! A Death Match To See How Many Cum Shots Ayuka Kuroda Can Ejaculate!

  • ayuka kuroda censoredcreampiehandjobYMDSmomotaro video publishinghimrockyoung peachYMDS-015YMDS015ymds00015
    • 2021-01-16
    113 min

    [ROYD-037]I Confessed My Love For The First Time To The No.1 Slut At School! "If We're A Good Match Sexually, I'll Go Out With You!" And Then She Gave My Cherry Boy Cock A Test Ride! Yui Kawai

  • yui kawai censoredcreampieschoolgirlROYDroyalcognac kaminohhh groupROYD-037ROYD037royd00037
    • 2021-01-17

    FC2PPV 1648961 Limited to 3 days [Individual shooting] Slender thirty wife, sobbing with another stick and vaginal cum shot twice

  • amateur uncensoredfc2
    • 2021-01-24
    54 min

    FC2PPV 1658307 [Personal shooting] Sex with a perverted fifty aunt who can’t control her lust!

  • amateur uncensoredfc2
    • 2021-01-25
    67 min

    345SIMM-596 I love my brother ♪ Bracon obedient steal the eyes of my sister and parents

  • amateur censoredcreampieuniformsimmsimm-596simm596345simm-596
    • 2021-01-29
    12 min

    FC2PPV 1663712 Until 1st 1480pt → 1180pt [Personal shooting] Slender young wife’s underwear is put on and taken off in the kitchen and raw insertion cum shot NTR

  • amateur uncensoredfc2
    • 2021-01-30
    122 min

    [MIAA-386]Machine Gun Cumshot Titty Fuck Soapland Girl Nene Tanaka

  • nene tanaka censoredbig titssingle workMIAAmoodyzeighteveryone s porn starMIAA-386MIAA386miaa00386
    • 2021-02-03
    77 min

    259LUXU-1371 Luxury TV 1361 A beautiful singer with beautiful big tits is here! If you insert a big cock into the vagina that has become thick with caress, you will accept it with a fascinating expression, and you will also expose your bewitching app

  • amateur censoredbig titsamateurluxuluxu-1371luxu1371259luxu-1371
    • 2021-02-11
    119 min

    [GUN-748]I Want To Lick The Feet Of These Beautiful Girls Until They Get Soaked! II

  • kuraki bookmark star ameri censoredbukkakeGUNradixmg yukkybatsugun paradoxGUN-748GUN748433gun00748
    • 2021-02-16
    53 min

    H4610 ki210216 Rika Shirahara 24years old

  • amateur uncensoredh4610
    • 2021-02-17
    59 min

    SIRO-4428 [First shot] [Cool girlfriend ..] [Smeared in cloudiness] A serious girl with a cool reaction actually made a big stain on her underwear. Honest body seeks pleasure .. AV application on the net → AV experience shooting 1466

  • amateur censoredamateursirosiro-4428siro4428siro-4428
    • 2021-02-22
    89 min

    [BAB-026]Creepy G*******gers (A Private Video Session) Bukkake Sex With A Natural Airhead Kanon

  • natural kanon censoredblowjobsingle workBABbabylon daydreamersBAB-026BAB026bab00026
    • 2021-03-12
    67 min

    [DPL-001]Number One Marathon Runner At The Prefectural Competition In Middle School ~ Fucking An Athletic Beauty With Toned Muscles ~ Saki Konno 22 Years Old

  • konno saki censoredcreampiesingle workDPLcaprangerDPL-001DPL001h-1557dpl00001
    • 2021-03-12
    94 min

    [XRW-984]Beautiful Bondage Babe Wants To Get Spanked - And Deep Throat Your Dick! 3

  • rei hanamiya mika ichijo censoreddeepthroatXRWreal worksreal real worksXRW-984XRW984172xrw00984
    • 2021-03-12
    77 min

    [DHT-249]A Wonderful Lady I Just Came To The City To See My Son... Woman Gets Seduced By A Handsome Pick Up Artist Mitsuyo-san 49 Years Old

  • censoredamateurmature womanDHThot entertainmentblade take leeDHT-249DHT24959dht00249
    • 2021-03-15
    481 min

    [PYM-370]Self Shots 40 Women Spraying Pussy Juice, Riding Dick Cowgirl Style, And Masturbating With Dildos 8 Hours

  • censoredPYMprimoPYM-370PYM370h-283pym00370
    • 2021-03-23
    124 min

    [STARS-345]Sharing A Room With Her Virgin Coworker During A Business Trip Cosmetics Maker Boss Gets Fucked And Kissed Until The Next Morning Suzu Honjo

  • suzu honjo censoredsingle workSTARSsod createdragon nishikawasod starSTARS-345STARS3451stars00345
    • 2021-04-02
    164 min

    [SSIS-034]Enjoying Licking And Bouncing Meaty 105cm J-Cup Tits 160 Minute Full Course Aka Asuka

  • arisu aka censoredbig titssingle workSSISs1 no 1 stylemon cSSIS-034SSIS034ssis00034
    • 2021-04-09
    150 min

    [JUFE-276]Blowjob-Loving Slut - F-Cup College Girl Yumeka Kikukawa Getting A Science Degree Makes Her Porn Debut! She Loves The Feel Of Living Things In Her Mouth

  • yumeka kikukawa censoredbig titsblowjobJUFEfitchmichiru arashiyamaJUFE-276JUFE276jufe00276
    • 2021-04-10
    88 min

    FC2PPV 1762510 Celebration! The 5th thank-you project that has exceeded 20,000 in total! [No individual shooting, apt outflow, dark route married woman edition] Please do not show it to your husband! A large amount of semen is injected into a beautif

  • amateur uncensoredfc2
    • 2021-04-21
    55 min

    492JCHA-009 It’s really unpleasant, but for some reason it comes out

  • amateur censoredamateurbeautiful girljchajcha-009jcha009492jcha-009
    • 2021-04-29
    112 min

    [IRO-044]Married Woman Groping Train ~ Fifty Year Old Mother Gets Ravished ~ Makiko Tsurugawa

  • makiko tsurukawa censoredcreampiemarried womanIROcenter villagesouthern earthzora center villageIRO-044IRO044h-086iro00044
    • 2021-05-07
    162 min

    [IPX-655]I Can No Longer Live Without Sex ... 209 Heavenly Orgasms 2548 Vaginal Spasms 3011 Demonic Piston-Pounding Thrusts Squirts Of Pleasure: Immeasurable Orgasmic Awakenings Ema Futaba

  • futaba emma censoredsquirtingbeautiful girlIPXidea pocketdragon nishikawadishIPX-655IPX655ipx00655
    • 2021-06-01
    38 min

    475SKCK-035 Himena 3

  • amateur censoredanalamateurskckskck-035skck035475skck-035
    • 2021-06-08
    40 min

    326HGP-020 [Back Customs] Creampie to a beautiful accountant in Tokushima! !! A metamorphosis that cums with nice ass spanking! A natural unfussy beautiful wife with a tall x artistic slender body is blamed and a big explosion of de M nature and bott

  • amateur censoredcreampiemarried womanhgphgp-020hgp020326hgp-020
    • 2021-06-19
    146 min

    [CAWD-242]Tempting Knee High x Total Domain: HinanoTachibana

  • hinano tachibana censoredsingle workCAWDkawaiitake dCAWD-242CAWD242cawd00242
    • 2021-07-06
    35 min

    493NAEN-081 Former Kano! ？？ Gonzo individual shooting! ？？ After going to drink with ex-girlfriend, I went to the hotel and took a Gonzo Hosho Lily

  • amateur censoredamateurbeautiful girlnaennaen-081naen081493naen-081
    • 2021-07-17
    177 min

    [CAWD-251]This Beautiful Girl With Light Skin Is An Underground Idol Who Is Getting Licked By Slobbering Otakus And Drenched In Drool And Semen As She Gets Her First Experiences In Orgasmic Ecstasy! She Came So Hard That Her Body Was Super Charged Wi

  • moeka momoyama censoredsquirtingsingle workCAWDkawaiikannana dainanaCAWD-251CAWD251cawd00251
    • 2021-07-24
    54 min

    [DANDAN-006]"This Old Lady Can't Wait..." The Sensual Therapist In A Legit Massage Parlor That Invites A Boner. Her Secret Option That Leaves You Breathless. Miss Mina ( 30 Years Old) I Cups.

  • censoredbig titshandjobDANDANdandytanaka baconDANDAN-006DANDAN0061dandan00006
    • 2021-08-13
    158 min

    [BLK-510]6 Super Sex Club Situations SPECIAL Maria Nagai x The Star Group, A Major Sex Club Chain 6 Clubs Worth Of Hot Plays A Comprehensive Collection

  • maria nagai censoredbig titsslutBLKkira kirasamoarikira hosi kira black galBLK-510BLK510blk00510
    • 2021-08-16
    113 min

    FC2PPV 2035855 Complete Appearance ♥ ️ 161/40 Super Slender Fair-Skinned Nude ♥ ️ Neat And Chaste Beautiful Wife Forbidden Ntr Affair Sex ♥ ️ De M Nature Is Exposed In The Shame Play Of The Daytime … ♥ ️ ♥ ️

  • amateur uncensoredfc2
    • 2021-09-09
    159 min

    [SW-797]My Classmate First Love With Big Tits And My Female Teacher With A Big Ass Meet At The Class Reunion To Fuck! 10 Years Later She Is a Married Woman With A Curvy Ass And Tits, Now I"m Too Hard And She"s Working My Dick At The Store, Ho

  • censoredbig titsSWswitchyocchanswitch hibinoSW-797SW7971sw00797
    • 2021-09-18
    50 min

    H0930 ori1612 Sayaka Matsuura 27years Old

  • amateur uncensoredh0930
    • 2021-09-24
    96 min

    529STCV-017 Rurucha.

  • amateur censoredcreampieamateurstcvstcv-017stcv017529stcv-017
    • 2021-10-17
    75 min

    FC2PPV 2354094 [6980 → Limited Number Of 4980pt] [First And Last Complete Appearance] 27-Year-Old Slender Beautiful Wife In Kyoto ❤️ Gentle Yamato Nadeshiko … I Think! ？？ It Was A Transcendental Nympho Wife ❤️ Massive Vaginal Cum Shot With Conti

  • amateur uncensoredfc2
    • 2021-10-20
    42 min

    FC2PPV 2360552 [New Work, Half Price! ] ♀ 307 Female College Student Hina ◯ -Chan 19 Years Old 2nd Time Otsumu And Omata Are Loose Fair-Skinned Busty G-Cup Lady Jd Is Once Again A Genuine Vaginal Cum Shot On A Super Dangerous Day! Unhappy Baby Concei

  • amateur uncensoredfc2
    • 2021-10-30
    140 min

    [SOAN-068]Naive Islander Sanshin Street Perfomer Has To Take Double Penetration In Her Round Ass For Cash... But Miss Kuran Herself Gives Assent With Her Desperate Cries. Itou Kuran

  • red orchid censoredsingle workbukkakeSOANyama to soratanizoko fu taroukoumon houmonSOAN-068SOAN068soan00068
    • 2021-11-05
    51 min

    [ssk-034]ひなこ 4

  • amateur censoredcreampieschoolgirlsskssk-034ssk034ssk-034
    • 2021-11-06
    163 min

    [FLAV-283]HYPER FETISH High-legged Slutty Queen Hazuki Wakamiya

  • wakamiya censoredslutsingle workFLAVdigital arkdigital ark dejitarua kuFLAV-283FLAV283flav00283
    • 2021-11-11
    124 min

    [FSDSS-320]I Won"t Let You Go Even If Your Hips Are Shattered! Standing Back Handle To Penetrate Deep Into Vagina Arina Hashimoto

  • there is hashimoto censoredFSDSSfalenoyamaguchi memberfaleno starFSDSS-320FSDSS3201fsdss00320
    • 2021-11-16
    113 min

    [KTRA-346]Record of "Meru" Step-Niece and Step-Uncle Meru Ito

  • meru ito censoredcreampiecosplayKTRAk tribeKTRA-346KTRA346
    • 2021-12-03
    56 min

    FC2PPV 2484058 [No] First Shot ♥ 20-Year-Old Short Hair, Shy Ubu Girl Made Her Av Debut ♡ I Put A Lot Of Adult Radical Play Into An Immature Sensitive Body WW

  • amateur uncensoredfc2



    • Japan xxx, japanese adult videos, japani sexy, Japanese Adult Movies, JAV censored, Japanese tube, Japanese sex online