cowgirl def big tits javcensored jav




FC2NATRCESDAPODJUFEKBIAUKGAVSAWANZATIDSTARSDTTSQTESHKDCAWDMVSDNACRSDABCHRVWAAABBAN

2020-11-13
171 min

[DSS-218]We Seduced An Amateur!! No.218 A Tokyo Seaside Vacation Bikini Edition

  • censoredbig titsamateurDSSmomotaro eizodukelady huntersDSS-218DSS218dss00218
    • 2020-11-13
    128 min

    [DBER-088]Cruel Orgasm Bench Part 2 - Writhing Female Flesh Cumming Until She Collapses - Featuring All-New Footage! 7 Girls' Extreme Orgasms

  • sachiko minami saya censoredbdsmDBERbabyentertainmentred babeDBER-088DBER088dber00088
    • 2020-11-19
    140 min

    [MMUS-045]I'll Definitely Pull Out: Tempting Little Devil Sisters, Ichika Matsumoto, Ruka Inaba

  • ichika matsumoto inaba censoredslutMMUSmarrionkijin kasaikcpMMUS-045MMUS045mmus00045
    • 2020-11-22
    120 min

    [HND-917]Aggressive Woman With Big Tits Abstains From Sex For 30 Days And Turns Into Pure Fiend! She Gets Fucked And Creampied For A Full Day From Morning To Night Before She's Finally Satisfied!! Ayaka Mochizuki

  • ayaka mochizuki censoredcreampiebig titsHNDhon nakamichiru arashiyamaHND-917HND917hnd00917
    • 2020-11-27
    97 min

    FC2PPV 1585277 [End of no sale] Super deals! Large volume for a total of 3 hours! !! Masturbation, Blow-free pack + 1 piece of work in storage [Personal shooting]

  • amateur uncensoredfc2
    • 2020-11-29
    101 min

    [VENU-980]I Want To Go To Hawaii For New Year's!

  • dongguan censoredcreampiemature womanVENUvenusmajime kitanofakecest winntersVENU-980VENU980venu00980
    • 2020-12-05
    33 min

    210AKO-409 MISAKI

  • misaki censoredamateurakoako-409ako409210ako-409
    • 2020-12-08
    118 min

    FC2PPV 1588973 [Personal shooting] Madoka-chan, a big-breasted hairdresser who loves belochu, subjective and objective set

  • amateur uncensoredfc2
    • 2020-12-12
    118 min

    [MEYD-636]Actually, I Keep Getting Fucked By My Husband's Boss... Sakura Misaki

  • cape sakura censoredcreampiesingle workMEYDtameike gorohirokoji osakiMEYD-636MEYD636meyd00636
    • 2020-12-13
    76 min

    300NTK-483 Defeat a natural domestic I cup beautiful girl with a letter! !! The epicenter is Zubari boobs! !! This huge breasts! !! Rubbing! !! Rubbing! !! Sucking! !! Shake! !! I’ll taste it! !! Yamato Nadeshiko is a beautiful girl with huge br

  • amateur censoredcreampiebig titsntkntk-483ntk483300ntk-483
    • 2020-12-23
    16 min

    Caribbeancom 122320-001 The Undisclosed: Tit fxxk heaven Chiaki Hidaka

  • chiaki hidaka uncensoredhandjobcaribbeancom
    • 2020-12-25
    65 min

    FC2PPV 1620230 [God times bulletin] 60th shooting Mana ○ 4 years old, youngest in history, intense loli, intense chewy confirmed miracle creampie video [Personal shooting]

  • amateur uncensoredfc2
    • 2020-12-25
    243 min

    [OPSS-003]Amateur POV Busty Teacher 3

  • censoreduniformamateurOPSStmatitty teacherOPSS-003OPSS00355opss00003
    • 2020-12-29
    48 min

    C0930 tk0026 Yuu Imaki 28years old

  • amateur uncensoredc0930
    • 2020-12-31
    16 min

    FC2PPV 1627296 ≪Complete appearance → It’s really dangerous if you get caught≫ Re-appeared! Pachislot campaign gal drips man juice and finger masturbation ❤ I wear pantyhose directly as a hobby of compensated dating father ☆ I will take a close-

  • amateur uncensoredfc2
    • 2021-01-09
    120 min

    [IPX-592]102 Orgasms! 98 Spasms! 8600 cc Of Squirting! Extreme Erotic Trance Ecstasy FUCK Rio Kuriyama

  • rio kuriyama censoredbig titssquirtingIPXidea pocketinaballdishIPX-592IPX592ipx00592
    • 2021-01-10
    153 min

    [APOD-041]Clothing Store Clerk Miku (20) Has Her Face Coated In Gallons Of Cum Bukkake! Made To Walk Around Town After A Facial! Miku

  • censoredamateurbukkakeAPODapollo daydreamersapollo apollo daydreamersAPOD-041APOD041apod00041
    • 2021-01-13
    57 min

    FC2PPV 1643699 [Personal shooting / set sale] Married woman who devours a meat stick in a form that makes you want to suck

  • amateur uncensoredfc2
    • 2021-01-16
    94 min

    [hoi-154]なっちゃん(21)

  • amateur censoredamateurbeautiful girlhoihoi-154hoi154hoi-154
    • 2021-01-20
    22 min

    FC2PPV 1652349 [Personal shooting] Affair with a young slender married woman. Insert the underwear from the side of the pants and make vaginal cum shot.

  • amateur uncensoredfc2
    • 2021-01-22
    53 min

    [WKD-038]Amateur File

  • censoredcreampieslutWKDwaap entertainmentk westwWKD-038WKD0382wkd00038
    • 2021-01-27
    52 min

    230OREC-674 Suzu

  • amateur censoredcreampieamateurorecorec-674orec674orec-674
    • 2021-01-29
    61 min

    FC2PPV 1662148 Only now 980pt [First shot first cum shot] Gravure Shinozaki ● Love super similar !! 20 years old Geki Kawa baby face busty female college student and raw squirrel cum shot SEX, further reinsert and scrape sperm

  • amateur uncensoredfc2
    • 2021-02-06
    17 min

    FC2PPV 1674846 ☆ Limited number of 300pt discount! ☆ I love electric vibrator ❤ Miyu-chan’s super rare! Special release of private masturbation videos! !! [No / Individual shooting]

  • amateur uncensoredfc2
    • 2021-02-13
    45 min

    C0930 hitozuma1348 Itsumi Takekura 27years old

  • amateur uncensoredc0930
    • 2021-02-20
    62 min

    [WKD-039]A Video Sex Record Of Adultery, Committed During A Married Woman Secret Meeting Reiko Kobayakawa

  • kobayakawa reiko censoredcreampiebig titsWKDwaap entertainmentk westwWKD-039WKD0392wkd00039
    • 2021-02-22
    37 min

    FC2PPV 1697025 [No] [Limited to 100 pieces 2980 → 1480pt OFF!] Masturbation 3 times daily! ♥ ️ Raw Gonzo for girls with strong libido ♥ ️ Massive vaginal cum shot! !! ♥ ️ Body Bikun Bikun ♥ * Review benefits / Sexy underwear blowjob

  • amateur uncensoredfc2
    • 2021-02-27
    51 min

    C0930 ki210228 Mariko Miyazawa 24years old

  • amateur uncensoredc0930
    • 2021-03-13
    118 min

    [MEYD-663]NTR While Taking Shelter From The Rain I Was Listening To This Housewife Complain About Her Husband When We Got Caught In A Sudden Rainstorm We Took Shelter In My Apartment, And Then, This Married Woman (Whom I Work With At My Part-Time Job

  • ai mukai censoredcreampiesingle workMEYDtameike gorokazumaMEYD-663MEYD663meyd00663
    • 2021-04-08
    93 min

    [OKK-025]Gorgeous, Glistening Wet Bodies - Goddess In A Competitive Swimsuit - Aoi Kururugi - Enjoy Every Part Of A Petite Hottie Who Looks Barely Legal In A Nut-Busting Competitive Swimsuit! Hidden Camera Voyeur Footage From The Change Room: Close-U

  • aoi kururugi censoredbeautiful girlbukkakeOKKpersonal photography of fatherdivine swimmingOKK-025OKK0251okk00025
    • 2021-04-10
    43 min

    C0930 hitozuma1352 Kaho Kagaya 26years old

  • amateur uncensoredc0930
    • 2021-04-11
    62 min

    FC2PPV 1765021 First shot ♥ ️ Blonde short fair-skinned beauty big breasts with one-time melody seeding SEX! !! 【selfie】

  • amateur uncensoredfc2
    • 2021-04-15
    245 min

    [NPS-411]Real Pickup! Incredible Sex SK**ls Lead To Multiple Orgasms! Cock-Craving Creampie SEX 104 Orgasms, 15 Loads!

  • censoredcreampieamateurNPSpetersken kikuchinampaNPS-411NPS411h-021nps00411
    • 2021-05-01
    153 min

    [JUL-556]Beauty Among Beauties: Fresh Face Megu Mio Makes Her Porn Debut At Age 26! Rated Number 1 Prettiest Married Woman In The Akita, The Prefecture Ranked Number 1 In All Of Japan For Hot Babes

  • mio meg censoredmature womansingle workJULmadonnamametaro mamezawaJUL-556JUL556jul00556
    • 2021-05-08
    103 min

    [NSPS-990]Wife Is Fucked By Her Husband's Boss And Gets Pregnant 2 Haruka Noki

  • haruka nogi censoredmature womansingle workNSPSnagae stylenagaeNSPS-990NSPS990nsps00990
    • 2021-05-10
    54 min

    358WITH-100 Arisa (20) S-Cute With Girl Who Wants To See Touched And Gonzo H

  • amateur censoredcreampiesquirtingwithwith-100with100358with-100
    • 2021-05-23
    118 min

    420POW-003 Osuzu [Talent activity / Big breasts Lori / Big butt / Beautiful skin / Climax] The impeccable dirty body is praised by users! A beautiful girl with huge breasts who has been scouted in a local city and is currently active as a talent! Sha

  • amateur censoredbig titsuniformpowpow-003pow003420pow-003
    • 2021-05-29
    57 min

    358WITH-102 Maron (24) S-Cute With Gonzo SEX With A Beautiful Woman Who Self-lives At The Cowgirl

  • amateur censoredcreampiebig titswithwith-102with102358with-102
    • 2021-06-11
    39 min

    361SEKAO-156 Ash Hollywood from L.A

  • amateur censoredamateursekaosekao-156sekao156361sekao-156
    • 2021-06-12
    240 min

    [KDMI-036]Adolescence And Bloomers: Amazing!

  • hanaoto urara aoi kururugi censoreduniformKDMImillKDMI-036KDMI036kdmi00036
    • 2021-06-24
    53 min

    C0930 ki210624 Taeko Matsukawa 56years old

  • amateur uncensoredc0930
    • 2021-06-27
    60 min

    HEYZO 2554 Shaving and Fucking A Busty Married Wife! – Chisako Takahashi

  • amateur uncensoredcreampieheyzo
    • 2021-07-08
    93 min

    [OKP-087]Ai Shichimori Is A Beautiful Goddess In Panty Hose. Savor The Pantyhose Wrapped Tight Around The Shapely Legs Of this Lolita-Faced, Uniformed Vixen. From The Moist Soles Of Her Feet To The Tips Of Her Toes! Sometimes She Wants To Sit On Your

  • ai nanamori censoredsingle workbukkakeOKPoyaji no kosatsukouenji gorokami pantyhoseOKP-087OKP0871okp00087
    • 2021-07-15
    39 min

    413INST-139 [Sexual Spring] Omanko Full Bloom ★ First Creampie Video Now Doki Mecha Kawa Female College Student Get! Portio Is Pierced By The First Aphrodisiac Cock And Demon Convulsions Acme! 19-year-old Best Body Conceived With Whole Body And Ejacu

  • amateur censoredcreampieamateurinstinst-139inst139413inst-139
    • 2021-07-22
    164 min

    [MIFD-172]A Fresh Face I Want To Enjoy My Sexual Youth! She's Had Experience In The National Baseball Tournament! On The Bulletin Board, She's Listed Her Thread As A "Cute Female Manager" Who Lives In The Kanto Region This Beautiful G

  • mizuki mei censoredbig titssoloworkMIFDmoodyzmametaro mamezawamoodyz freshMIFD-172MIFD172
    • 2021-09-11
    211 min

    [BAZX-305]Full POV x Total Domain: Beautiful Y********l In Knee High Uniform vol. 001

  • censoredbeautiful girlBAZXk m producetodobazookaBAZX-305BAZX305bazx00305
    • 2021-09-25
    149 min

    [NITR-512]Filthy BODY: Tongue Kissing Addiction IV - Honoka Tsujii

  • tsujii honoka censoredcreampiebig titsNITRcrystal eizoupearlrice sakagaminitroNITR-512NITR512nitr00512
    • 2021-10-15
    149 min

    [EBOD-862]Adorable Girl With A Cute Haircut! This Cheerful Beauty From Hakata Has G-cup Tits. She"s Come To Tokyo From Fukuoka For Her E-BODY Deluxe Specialty AV Debut! Noa Tensei

  • ai tenharu censoredbig titsbeautiful girlEBODe bodyarashiyama michiruEBOD-862EBOD862ebod00862
    • 2021-11-05
    131 min

    [VENX-087]When His Stepmother Came Home From Her Part-Time Job, Her Stepson Lost His Mind When He Sniffed Her Pungent, Sweaty Smell Yuko Shiraki

  • shiraki yuko censoredcreampiebig titsVENXvenuspe taincest vi nasuVENX-087VENX087venx00087
    • 2021-12-11
    185 min

    [DNJR-064]Real Ejaculation Management To Watch One Scene At A Time, One Day At A Time Mao Hamasaki

  • hamazaki mao censoredbig titsslutDNJRdog daydreamersmaboroshikoDNJR-064DNJR064dnjr00064
    • 2021-12-17
    177 min

    [JUFE-354]I Just Got Married And I"m Going On A Business Trip With My Female Boss - Now We Ended Up Sharing A Room. Made Into A Servant From Morning Till Night - Reverse NTR Cheating Scenario. Reona Tomiyasu

  • takehiro tomiyasu censoredcreampiebig titsJUFEfitchJUFE-354JUFE354jufe00354
    • 2021-12-20
    80 min

    318LADY-394 Mio (Mio Ichijo)

  • amateur censoreduniformschoolgirlladylady-394lady394318lady-394
    • 2021-12-30
    240 min

    [RD-1095]Fully Mature. A Married Woman Who Gets Wet Even Though She Says She Doesn"t Like It. 12 Women, 4 Hours.

  • amateur censoredmarried womanmature womanRDatena eizouRD-1095RD1095
    • 2021-12-31
    80 min

    355OPCYN-225 Yuuna 2 (Yuna Himekawa)

  • amateur censoredamateurbeautiful girlopcynopcyn-225opcyn225355opcyn-225
    • 2022-01-08
    125 min

    [BAAM-005]"I Don"t Want An Older Man!" Riri Is A Beautiful College S*****t Gal Who Was Tricked Into Thinking She Would Be Getting Someone Handsome

  • censoredBAAMbaltanamazonessBAAM-005BAAM005baam00005
    • 2022-02-10
    121 min

    [GUN-873]Something You Shouldn"t Do: Playing At Wetting Yourself. Hikaru Minazuki

  • hikaru minazuki censoredcosplaybeautiful girlGUNradixshio sakurabaexceptionalGUN-873GUN873433gun00873



    • Japan xxx, japanese adult videos, japani sexy, Japanese Adult Movies, JAV censored, Japanese tube, Japanese sex online