censored jav creampie high vision restraint




FC2MIDVMEYDDASDIPXVEMANATRAUKGCJODATIDSQTENACXAUKGAVSACAWDMVSDNACRMIAASSNIAWDPPPD

2020-12-08
118 min

FC2PPV 1588973 [Personal shooting] Madoka-chan, a big-breasted hairdresser who loves belochu, subjective and objective set

  • amateur uncensoredfc2
    • 2020-12-12
    24 min

    H4610 ki201212 Self Shot

  • amateur uncensoredh4610
    • 2020-12-12
    60 min

    Caribbeancom 121220-001 Grab and squeeze my boob! Yukie Natsuki

  • yukie natsuki uncensoredcreampiecaribbeancom
    • 2020-12-25
    239 min

    [YTR-150]Kotone Toa - Total Coverage - 4 Hours Of Fucking

  • toua kotone censoredcreampiedeepthroatYTRnonYTR-150YTR150h-127ytr00150
    • 2020-12-25
    240 min

    [GIGL-631]Picking Up Girls - These Young MILFs Have Dead Bedrooms These Days And Are Desperate For A Quick Fuck! Taking Advantage Of Horny, Frustrated Wives! 12 Girls

  • censoredbig titsmomGIGLgigolo gigologigoloGIGL-631GIGL631h-860gigl00631
    • 2020-12-27
    60 min

    C0930 ki210101 Kazumi Miyata 34years old

  • amateur uncensoredc0930
    • 2020-12-31
    200 min

    [HUNTA-918]The Most Popular Booth At This Private Girls' High School Festival, "The Quickie," Offers Refreshments To A Long Line Of Customers. Just What Could Be Inside？!

  • censoredcreampieschoolgirlHUNTAhuntermasanorihhh groupHUNTA-918HUNTA918hunta00918
    • 2021-01-18
    31 min

    FC2PPV 1649971 [Personal shooting / Creampie] Lotion that soaks into a mature naked body. The roar of a mature wife echoes with deep pleasure …

  • amateur uncensoredfc2
    • 2021-01-23
    62 min

    FC2PPV 1656723 For a married woman who came to shoot with children, 2 consecutive vaginal cum shots, first vaginal cum shot, individual shooting, individual shooting completely original 90th person

  • amateur uncensoredfc2
    • 2021-01-24
    132 min

    [OPPW-082]You're My Dress-Up Doll Sakuya Yuki

  • sakiya yuki censoredsingle workOPPWopenipeni world mousouzokuumanosukeOPPW-082OPPW082oppw00082
    • 2021-02-07
    141 min

    [PKPD-132]My Female Acquaintance: Creampies Are OK, 18 Years Old, A Girl With Pale Skin, Pink Nipples, F-cup Rina Takase

  • rina takase censoredcreampiebig titsPKPDfuck group and fun friends daydreamersPKPD-132PKPD132pkpd00132
    • 2021-02-11
    135 min

    [SW-756]I Like Older Men. My Friend's Little Sister Was Totally My Type, And She Was The Kind Of Sch**lgirl Who Loved To Lure Men To Temptation! She Got Me Hot And Hard With Her Total Domain Of Knee-High Socks, And Tempted Me With Her Sweet Voice

  • kagami sara censoredschoolgirlsingle workSWswitchSW-756SW7561sw00756
    • 2021-02-11
    165 min

    [SVDVD-841]Smart, Sexy Private School Tutor Who Makes Big Bank Used As Spit-Slathered Cum Dumpster. Railed By Filthy Rods Down To Her Womb, Bred By Creampie Sex!

  • tsukishima sakura yumina hirosaki censoredcreampiebig titsSVDVDsadistic villagejiro tsubuyakibanging girlsSVDVD-841SVDVD8411svdvd00841
    • 2021-02-20
    89 min

    [KIR-027]My Boss's Wife Seduced Me By Revealing Her Huge Tits And Flashing Me Her Panties... Wakana Shiroyama

  • shiroyama wakana censoredcreampiebig titsKIRstarkireiKIR-027KIR027h-254kir00027
    • 2021-02-23
    37 min

    FC2PPV 1698252 [Personal shooting] ♀294 Female college student Ma ◯ -chan 18 years old 2nd time J-cup back dirt girls with tens of thousands of followers completely fell into a middle-aged old man’s conceived sex-treated meat urinal!

  • amateur uncensoredfc2
    • 2021-02-27
    143 min

    [JKSR-482]10 A.M.: Shouldn't You Be At School, Urara？ Urara Kaon

  • hanaoto urara censoredcreampieschoolgirlJKSRbig morkalobockeyprink junkyJKSR-482JKSR48257jksr00482
    • 2021-03-05
    66 min

    [SZKK-016]My Step Daughter Would Never... H

  • sakata mihono censoredsoloworkSZKKorustak softmasturbation supportSZKK-016SZKK016
    • 2021-03-12
    134 min

    [ABW-065]She'll Absolutely Look Down Upon You With Contempt Horny Hospitality The Hottest Babe Remu Suzumori 17

  • suzumori remu censoredanalbig titsABWprestigecharlie nakataabsolutely wonderfulABW-065ABW065118abw00065
    • 2021-03-13
    240 min

    [HJMO-455]Best Friends Face Off! Fixed Dildo Hip Grinding Contest, They Can't Go Home Until They Grind 1000 Times!! 9

  • censoredsquirtingHJMOhajime kikakujohan yuanHJMO-455HJMO455hjmo00455
    • 2021-03-26
    118 min

    [MIAA-413]I Found My Friend's Daughter On A Sugar Daddy Site! I Wore A Costume And Made Her Wear A Blindfold So She Wouldn't Recognize Me As I Gave Her Creampie After Creampie Asuka Momose

  • momose asuka censoredcreampieblowjobMIAAmoodyzrakudaeveryone s porn starMIAA-413MIAA413miaa00413
    • 2021-03-26
    100 min

    [YSN-542]My New Step Sister Is A Terrible Person But My Penis Can't Help But Get Hard Nene Tanaka

  • nene tanaka censoredcreampiebig titsYSNnonYSN-542YSN542h-127ysn00542
    • 2021-04-14
    225 min

    [HUNTA-992]"I Can't Take It Anymore! My Pussy's Going To Break!" While My Brother Was Away On A Work Trip, My Sister-In-Law Fell In Love With My Cock! We Both Came Hard To Extreme, Grinding Piston Cowgirl Fucks!

  • censoredcreampieblowjobHUNTAhuntervolvo nakanohhh groupHUNTA-992HUNTA992hunta00992
    • 2021-04-26
    64 min

    328HMDN-357 [Gachi Flirt] Kyoto’s Hannari Beautiful Wife 24 Years Old Called And Seeded While Shopping With Her Husband And Returned! De Nasty Slut Wife Who Makes A Call So That It Does Not Barre And Get Drunk With Convulsions Acme [Personal Sho

  • amateur censoredcreampiemarried womanhmdnhmdn-357hmdn357328hmdn-357
    • 2021-04-27
    130 min

    [STARS-367]"It'll Be A Month From Now ... Before We Meet Again ..." I'm In A Long Distance Relationship With My Girlfriend, And So We Used What Little Time We Have Together To Furiously Creampie Fuck Until My Balls Are Drained Dry As

  • makoto toda censoredcreampiebeautiful girlSTARSsod createnamero ajinosod starSTARS-367STARS3671stars00367
    • 2021-05-04
    103 min

    FC2PPV 1801647 First shot ♥ ️ Complete appearance ♥ ️ Professional student 20 years old who looks good with long hair ♥ ️ Devoted blowjob & raw etch first experience of fair-skinned beautiful girl with beautiful legs & nice ass ♥ ️ The vaginal

  • amateur uncensoredfc2
    • 2021-05-08
    120 min

    [MDTM-724]This Excessively Sensual Married Woman Who Had Plenty Of Lust To Spare Remained Celibate For A Month, And Because Her Husband Was Shooting Blanks And Suffering From Erectile Dysfunction, She Went To A High-Class Hotel With A Big Dick Single

  • himesaki hana censoredcreampiebig titsMDTMuchu kikakutodoMDTM-724MDTM724mdtm00724
    • 2021-05-17
    56 min

    FC2PPV 1821913 [Active CA, 18th] Sayuri ♡ 22 years old ♡ Cute, beautiful breasts, bristle record ♡ With benefits

  • amateur uncensoredfc2
    • 2021-05-23
    63 min

    FC2PPV 1832637 An executive of a fast-growing rumored venture company and a miracle H ❤️❤️ I have vaginal cum shot twice as I desire ❤️❤️

  • amateur uncensoredfc2
    • 2021-06-01
    121 min

    [NACR-423]My Brother's Wife Fell Into A Trap - Mirei Aikawa

  • aikawa mirei censoredcreampieblowjobNACRplanet plusdirector onanakuruNACR-423NACR423h-237nacr00423
    • 2021-06-05
    109 min

    390JAC-092 [Perfect BODY x 5 consecutive vaginal cum shot] what ’s up Tokai ON AIR？ No, no, no, no, no, no, no, no, no, no, no! Supported by celebrities in each media, the gal boss is still fine today! Tokai respect collaboration request! Cheer up! D

  • body censoredcreampiebig titsjacjac-092jac092390jac-092
    • 2021-06-26
    50 min

    Pacopacomama 062621_495 This is My Rule, Just Enjoy Deep Throating! Sakura Kazuki

  • amateur uncensoredpacopacomama
    • 2021-07-01
    121 min

    [NACR-435]"Take Me..." A Single Mother In Love With Her Neighbor, Starring Swan Shiratori

  • swan censoredcreampieblowjobNACRplanet plusdirector oshichi ku ryuuNACR-435NACR435h-237nacr00435
    • 2021-07-02
    42 min

    520SSK-009 Haru

  • amateur censoredamateurbeautiful girlsskssk-009ssk009520ssk-009
    • 2021-07-20
    89 min

    Caribbeancom 072021-001 Non Stop XXX for 180min : Orgy and Non Stop Orgasm Vol.1 Rino Sakuragi

  • rino sakuragi uncensoredcreampiehandjobcaribbeancom
    • 2021-07-27
    102 min

    451HHH-028 AV First Experience [Iki Sweat! ] [Lots Of Juice! ] [Hot And Humid Sex! !! ] Frustration ● This Favorite Nurse Challenges Her Climax Limit! High Viscosity, Super Close Contact Copulation That Is Born For The First Time When Serious Sexual

  • amateur censoredamateurhhhhhh-028hhh028451hhh-028
    • 2021-08-13
    119 min

    [PPPD-951]We"ll Send You The Big Tits Ex Sports Commentator Bitch That Gives You Titty Fuck Blowjobs Instantly. Reona Tomiyasu

  • takehiro tomiyasu censoredcreampiebig titsPPPDoppaiPPPD-951PPPD951pppd00951
    • 2021-08-14
    60 min

    SIRO-4563 [First Shot] [Style ○ × Skin Quality ○ × Reaction ○] [Slutty Serious Girl’S Foolery] A 19-Year-Old Moody Beautiful Girl Who Aims To Become A Veterinarian Appears. Her Sensitive Young Skin Makes Her Cute Roar To Her Hard Roots And Erect

  • amateur censoredamateursirosiro-4563siro4563siro-4563
    • 2021-08-30
    45 min

    FC2PPV 2106715 [Face Exposure] A Beautiful Hairless Beauty. She Commits A Stupid Female Toy With A Large Number Of Employees And Makes Vaginal Cum Shot.

  • amateur uncensoredfc2
    • 2021-09-02
    53 min

    FC2PPV 2129123 [2021/9/30 Completely Deleted] [D.C] My Sister Gal Is Retiring, So I Tried To Release Sex Out In Private. 6th ① Creampie ☓3 [Sayaka-Chan] Completely Retired

  • amateur uncensoredfc2
    • 2021-09-15
    481 min

    [RVG-141]Mom"s Real Sex Education Best Hits Collection vol. 7

  • yuri chitose mika ichijo censoredmilfdramaRVGglory questRVG-141RVG141rvg00141
    • 2021-10-14
    59 min

    FCP-047 [Distribution Only] Put Out All! Cum Swallowing Vacuum Blow ＃ 1

  • amateur censoredamateurslutfcpfcp-047fcp047fcp-047
    • 2021-10-20
    30 min

    279UTSU-520 Yuri-San

  • amateur censoredmarried womanamateurutsuutsu-520utsu520279utsu-520
    • 2021-10-25
    44 min

    FC2PPV 2369256 Appearance! !! Limited Number! [Uncensored] A Holiday Date With A Kindergarten Teacher Who Has A Strong Libido To Seduce With A Sweet Voice! Outdoor Obscenity On A Boat In The Park … Creampie In A Nasty Body That Feels The Climax

  • amateur uncensoredfc2
    • 2021-10-29
    162 min

    [MIAA-521]The Absolute Aerial Domain She"ll Jam Your Cock Into Her Silky Smooth Cunt Crack And Between Her Thighs And Toy With You Because She"s A Devilish Barely Legal Babe Ichika Matsumoto

  • ichika matsumoto censoreduniformslutMIAAmoodyzmasaki naominna no kikatanMIAA-521MIAA521miaa00521
    • 2021-11-11
    118 min

    [JURA-044]First Time Shots Dear Wife, Once Again. Asako Kotoriyu

  • asako kotori censoredcreampiemarried womanJURAcenter villagesouthern earthjurakuJURA-044JURA044h-086jura00044
    • 2021-12-10
    137 min

    [ROE-028]My Mother Is Getting Remarried... I"m So Jealous I Can"t Stop Myself From Fucking

  • good miki ryoko izawa miki yoshii censoredcreampiemature womanROEmadonnaunicorn fukudamonroeROE-028ROE028roe00028
    • 2021-12-17
    120 min

    [EBOD-882]I Used This Hookup App (T*nd*r) That Has Lots Of Young And Cute Girls Online To Meet Rima-chan (20 Years Old), A Beautiful Girl With F-Cup Tits And A Super Sexy Tight Waist Who Works At A Popular Concept Cafe In Ka**kicho, And I Got All The

  • censoredcreampiebig titsEBODe bodymichiru arashiyamaEBOD-882EBOD882ebod00882
    • 2021-12-24
    242 min

    [ID-036]Rough Sex Busty Wife Hot Spring - 4 Hours

  • censoredcreampiecosplayIDtmatorindoru tanakaID-036ID0365527id00036
    • 2021-12-29
    69 min

    OREX-336 Mikako-san (Mikako Horiuchi)

  • amateur censoredcreampiebig titsorexorex-336orex336orex-336
    • 2021-12-31
    166 min

    [DVDMS-757]A Big Titty Step Aunt Has A Shotacon Downfall Into Pleasant Ecstasy - She Always Treated Her Step Nephew Like A C***d, But For The Next 7 Days, He Pumped Her With Continuous Creampie Sex With His Uncircumcised Big Cock - Monami Takarada

  • takarada monami censoredcreampiebig titsDVDMSdeep sbieber gonzoDVDMS-757DVDMS757dvdms00757
    • 2021-12-31
    117 min

    [MIAA-551]I"m The Only One Who Knows The True Face Of Our S*****t Council President. She"s The Number One Neat And Clean Classmate, But She Was Rudely And Crudely Showing Off Her Anal Hole To Me And Lured Me To Temptation And Proceeded To Cre

  • white peach censoredanalcreampieMIAAmoodyztiger kosakaieveryone s porn starMIAA-551MIAA551miaa00551
    • 2022-01-08
    139 min

    [URKK-051]The Perverted Landlord Next Door Rubs My Tits And Fucks Me Every Day. Hana Himesaki

  • himesaki hana censoredcreampiebig titsURKKunfinishedrolanda familiar breastURKK-051URKK051urkk00051
    • 2022-01-24
    82 min

    444KING-061 Haruru

  • amateur censoredcreampiesquirtingkingking-061king061444king-061
    • 2022-02-10
    121 min

    [FSDSS-369]絶対に本番はしないから！彼女になった風俗嬢に盗聴レコーダーを仕掛けたら…桃尻かなめ

  • kaname momojiri censoredbig titssingle workFSDSSfalenobipartite pairing index of 25faleno starFSDSS-369FSDSS3691fsdss00369
    • 2022-02-19
    124 min

    [CEAD-395]A Certified BBW MILF. The Adult Video Debut Of Ai Sonoda.

  • sonoda ai censoredbig titsmature womanCEADceleb no tomoCEAD-395CEAD395cead00395
    • 2022-02-25
    240 min

    [IBW-859]Super Select Videos Of Lo**ta Beautiful Girl Babes, Bending Over Backwards During Missionary Position Sex 4 Hours

  • amateur censoredbeautiful girlIBWi b worksIBW-859IBW859



    • Japan xxx, japanese adult videos, japani sexy, Japanese Adult Movies, JAV censored, Japanese tube, Japanese sex online