yui




FC2KBIJULMILKIPXMEYDNACRSSISCAWDSPRDMVSDADNDASDAWDGVHATIDCJODDTTFSDSSJUFEAMBI

2018-10-21
117 min

[JUY-651]Watching My Wife's Friend's Sexy Work Out Drove Me Crazy... Yui Aihara

  • yui aihara censoredmature womansingle workJUYmadonnamametaro mamezawaJUY-651JUY651juy00651
    • 2018-10-20
    119 min

    [RUKO-016]Please Fuck My Wife...

  • nanase yui haneda future watch early censoredRUKOstar paradiseoshirukoRUKO-016RUKO016h-254ruko00016
    • 2018-10-19
    114 min

    [BIJN-142]The Body Of A Woman Who Has Completed Preparations To Receive Sperm In The Moment That She Cums, We're Going To Inject Her With Creampie Ejaculations Guaranteed To Impregnate This Bitch! Yui Hatano

  • yui hatano censoredcreampiemature womanBIJNbijin majo emmanuelleBIJN-142BIJN142bijn00142
    • 2018-10-19
    137 min

    [EMRD-109]She Became A Full-Body Sex Machine, From The Top Of Her Head To The Tips Of Her Toes, In Oil-Slathered Slippery Sex 3 Yui Miho

  • miho yui censoredbig titssingle workEMRDemperor mousouzokuenbu hiragiEMRD-109EMRD109emrd00109
    • 2018-10-19
    146 min

    [LZDM-020]A Schoolgirl Teases A Female Teacher. Naughty Lesbians Living Together Vol. 02 ~Their Very First One-On-One Lesbian Lesson~ Mari Takasugi, Yui Miho

  • mari takasugi miho yui censoredschoolgirllesbianLZDMlesrewild sevenlezure dramaLZDM-020LZDM020lzdm00020
    • 2018-10-19
    205 min

    [FCH-019]I Can't Stop Cumming! An Ultra Pleasant Beautiful Girl Handjob 5

  • maria serizawa yuri mochida censoredbeautiful girlhandjobFCHprestigefetish factionFCH-019FCH019118fch00019
    • 2018-10-18
    261 min

    [GDHH-124]I Can Die Happy Now! A Horny Happy Day With So Many Ultra Lucky Coincidences In A Row! These Are The Erotic Happenings Of Your Dreams, So Good Your Nose Won't Stop Bleeding From All The Excitement! 10

  • frightening ai hirano censoredGDHHgolden timekorosukehhh groupGDHH-124GDHH124gdhh00124
    • 2018-10-17
    136 min

    [GVG-759]Sexy PTA Chairwoman, The Sexy Female Teacher And The Bratty Student Council Yui Hatano , Ka Ayano Fuji

  • yui hatano ayano kato censoredmature womandramaGVGglory questhyonGVG-759GVG75913gvg00759
    • 2018-10-17
    131 min

    [OVG-089]"Oh! You're Inside Me Raw!" When Her Pussy And His Dick Were Rubbing Up Against Each Other In An Oiled Up Pussy Grind Session, It Felt So Good That His Dick Just Slipped Right In, Raw!! Delivery Health Call Girls Who Got Creampie

  • shinoda yu aichi michiru censoredcreampiebig titsOVGglory questOVG-089OVG08913ovg00089
    • 2018-10-16
    242 min

    [MXSPS-592]Women Get An Aphrodisiac Rubbed On Their Clits And Orgasm Repeatedly. 4 Hours

  • akiho yoshizawa kana yui censoredbig titsMXSPSmaxingMXSPS-592MXSPS592h-068mxsps00592
    • 2018-10-16
    119 min

    [MXGS-1071]Kana Yume In Private Sex

  • kana yui censoredsingle workMXGSmaxingMXGS-1071MXGS1071h-068mxgs01071
    • 2018-10-16
    240 min

    [NPS-364]Female Director Haruna's Amateur Lesbian Pickups. 20 Naive And Dirty Girls! They Rub Their Pussies Together For Their First Clam Jousting, Deluxe! 4 Hours

  • otsuki sound azusa kirihara azusa ito censoredamateurlesbianNPSpetersnampaNPS-364NPS364h-021nps00364
    • 2018-10-15
    122 min

    [ZEX-358]A Harlem ASMR Special!!

  • yui hatano otsuki sound censoredbig titsbeautiful girlZEXpeters maxZEX-358ZEX358h-720zex00358
    • 2018-10-13
    241 min

    [DVAJ-358]Sex In The Bath Highlights. 18 Women, 4 Hours

  • kawakami nanami yuma asami censoredbig titsbeautiful girlDVAJalice japansagi kandaDVAJ-358DVAJ358dvaj00358
    • 2018-10-13
    138 min

    [CESD-652]Old Man... Impregnate Me... Yui Miho

  • miho yui censoredcreampiebig titsCESDceleb no tomoenbu hiragiCESD-652CESD652cesd00652
    • 2018-10-13
    110 min

    [AVSA-075]My Very Own Dirty-Talking Sex Dolls. Special Version. Yui Hatano Hibiki Otsuki

  • yui hatano otsuki sound censoredAVSAavs collector savscollector sAVSA-075AVSA075avsa00075
    • 2018-10-13
    31 min

    [638_yui_k01]清楚な顔してお漏らしセックス／Yui

  • amateur censoredamateuryuiyui-k01yuik01638-yui-k01
    • 2018-10-13
    228 min

    [DVAJ-357]Massive Loads Of Cum On Their Faces. BEST. Normal Playback And Slow Motion. 105 Shots.

  • kawakami nanami minami kojima censoredbeautiful girlDVAJalice japansagi kandaDVAJ-357DVAJ357dvaj00357
    • 2018-10-12
    119 min

    [IPX-214]A Deep And Rich Lesbian Ban Lifting! 4 Mutually Orgasmic Lesbian Series Sex Sessions A New Sensation Orgasmic Experience Twisting Tongues Intertwining While Their Pussies Rub Up Against Each Other... Only A Woman Could Know Another Woman

  • amami tsubasa yui hatano censoredbig titslesbianIPXidea pocketzaku araidishIPX-214IPX214ipx00214
    • 2018-10-12
    121 min

    [SUPA-387]You Can Borrow My Wife All Night Long. Miss Yui, 28 Years Old

  • censoredcreampieamateurSUPAskyu shirotododo kunSUPA-387SUPA387h-244supa00387
    • 2018-10-11
    121 min

    [YPAA-019]My Wife Was Repeatedly Getting Fucked By Our Neighbors Yui Hatano

  • yui hatano censoredmarried womanmature womanYPAAcenter villagehazamadonntr center villageYPAA-019YPAA019h-086ypaa00019
    • 2018-10-11
    121 min

    [STAR-987]An SOD Star Mahiro Tadaii 18 Years Old A Full On Fuck Fest With An Erotically Cute Little Niece A 4 Days And 3 Nights Fuck Fest Staycation

  • mahiro yui censoredbeautiful girlsingle workSTARsod createshinya kimurasod starSTAR-987STAR9871star00987
    • 2018-10-11
    142 min

    [SDMU-889]The ASMR Dirty Talk Hospital Ward 24 Hours

  • otsuki sound yui hatano censoredbig titsuniformSDMUsod createtiger kosakaiSDMU-889SDMU8891sdmu00889
    • 2018-10-11
    132 min

    [FSET-790]The Most Embarrassing Hole! Intently Studying Their Assholes

  • minori otani yui imai censoredFSETaquinorifsetaknrFSET-790FSET7901fset00790
    • 2018-10-02
    131 min

    [SPRD-1058]This World Is Made For Men And Women Only The Lust Of A Father-In-Law And The Sexuality Of A Bride Yua Imai

  • yui imai censoredmature womansingle workSPRDtakara eizoshigeru kuromatsualeddinSPRD-1058SPRD105818sprd01058
    • 2018-10-02
    22 min

    [n1335]Tokyo Hot Secret Haunts Special =part2=

  • mami hoshina junko igarashi uncensoredtokyo hot
    • 2018-10-01
    240 min

    [NACX-019]Bare All! Yui Oba

  • oba yui censoredcreampiebig titsNACXplanet plusnanakuruNACX-019NACX019h-237nacx00019
    • 2018-09-29
    120 min

    [WANZ-800]Big Ass Maniacs Yui Tomita

  • yu tomita censoredcreampiesingle workWANZwanz factorywanzWANZ-800WANZ800wanz00800
    • 2018-09-29
    179 min

    [FINH-068]A Middle-Aged Man's POV Documentary. Sticky, Wet, Sweaty, Lustful Sex. Yui Miho

  • miho yui censoredcreampiebig titsFINHfitchnamadore headofficeFINH-068FINH068finh00068
    • 2018-09-28
    241 min

    [HMD-026]"I Never Knew That Sex Could Feel So Good..." She's Been Neglected By Her Husband, And Now Her Erotic Body Will Easily Welcome The Cock Of Another Man

  • mizuno chaoyang shinobu igarashi censoredcreampiebig titsHMDglobal media entertainmenthypermix global media entertainmentHMD-026HMD026143hmd00026
    • 2018-09-28
    240 min

    [OKAX-426]Seeing A Hot Woman Pissing Herself Is So Filthy It's Amazing! 4 Hours

  • yuna shiina ichika kamihata censoredbig titssquirtingOKAXk m produceokazuOKAX-426OKAX42684okax00426
    • 2018-09-28
    121 min

    [DFDM-008]Non-Stop Premature Orgasms. Yui Tomita

  • yu tomita censoredsquirtingdeepthroatDFDMwaap entertainmenteightfearlessDFDM-008DFDM0082dfdm00008
    • 2018-09-27
    105 min

    [KEED-050]A Mother Gets Fucked By Her Daughter's Boyfriend And Orgasms Over And Over Again. Yui Hikawa

  • yui ayukawa censoredcreampiemarried womanKEEDcenter villageshibuyahanazono center villageKEED-050KEED050h-086keed00050
    • 2018-09-23
    137 min

    [TCD-200]Pure Woman's Face Transsexual Losing Virginity Juri Kisaragi Yui Hatano

  • yui hatano kisaragi juri censoredTCDtrans clubenbu hiragiTCD-200TCD200tcd00200
    • 2018-09-23
    259 min

    [NSPS-749]Nagae Style Special Actress Slutty Ass Yui Oba Lust

  • oba yui censoredmature womansingle workNSPSnagae stylejotaro tomiNSPS-749NSPS749nsps00749
    • 2018-09-23
    133 min

    [APKH-076]Messy Pleasure Trip "I... Came Here To Do It With You..." Memories Of Fucking A Part Time Employee Who Left Her Husband At Home For A Slutty Sex Trip... Yui Okamoto

  • yui okamoto censoredmarried womanAPKHaurora project annexAPKH-076APKH076apkh00076
    • 2018-09-23
    117 min

    [AVSA-074]I Made A Huge Mistake And The Business Homepage Got A Badge Saying "Raw Sex OK"... A Ton Of Horny Customers With Smelly Cum Force Me To Be Pumped Full Of Their Liquids As Their Raw Sex Call Girl Yui Hatano (Yui Hatano)

  • yui hatano censoredcreampieAVSAavs collector sran fujiokaavscollector sAVSA-074AVSA074avsa00074
    • 2018-09-22
    117 min

    [DASD-462]She'll Drool And Slobber And Shake Her Ass She's Baring It All On This Stayover Vacation "A Horny Body That Will Blow A Dirty Old Man's Mind" Yui Miho

  • miho yui censoredcreampiebig titsDASDdassrokusaburo mishimaDASD-462DASD462dasd00462
    • 2018-09-22
    167 min

    [NNPJ-298][Sudden Porn Sale!] Innocent Angel Yui Appears In My Town And Kindly Helps With All My Needs! Complete Collection Of Our Experiences Taking This Slender Young Girl In Uniform For Lots of Sex!

  • censoredbeautiful girlNNPJnampa japanNNPJ-298NNPJ298nnpj00298
    • 2018-09-22
    118 min

    [HND-570]First Raw Creampie Yui Natsuhara

  • yui natsuhara censoredcreampiebeautiful girlHNDhonnakataiga kosakaiHND-570HND570hnd00570
    • 2018-09-22
    197 min

    [CJOD-160]Total Domain Nympho Harem Forced To Creampie Held Down By Her Beautiful Legs!!

  • otsuki sound shinoda yu censoredcreampieslutCJODslut havennanzaki masakiCJOD-160CJOD160cjod00160
    • 2018-09-22
    143 min

    [JUY-615]A Madonna Exclusive A Real-Life Fashion Model No.2!! Tongue-Twisting Kissing Sex So Intense She Forgot All About Her Husband Yui Aihara

  • yui aihara censoredbig titsmarried womanJUYmadonnamamezawa mametaroJUY-615JUY615juy00615
    • 2018-09-22
    116 min

    [JUY-626]Apartment Wife Faints At Cunnilingus Without Making A Sound Yui Miho

  • miho yui censoredbig titsmarried womanJUYmadonnaeitaro hagaJUY-626JUY626juy00626
    • 2018-09-21
    299 min

    [DOKS-450]Big Tits Dildo Masturbation 5 Hours 18 Horny Beautiful Women Who Are Seriously Cumming

  • kaede niiyama makihara aina censoredbig titsDOKSoffice k sDOKS-450DOKS45036doks00450
    • 2018-09-20
    232 min

    [IENE-931]Continuous Nipple Play In A Men's Massage Parlor 2

  • sakisui ichinose love censoredIENEi energyie nergyIENE-931IENE9311iene00931
    • 2018-09-20
    120 min

    [RUKO-014]I've Become Addicted To My Father-In-Law's Withered Old Dick...

  • yui hatano yukino kawai censoredmarried womanRUKOstar paradiseassRUKO-014RUKO014h-254ruko00014
    • 2018-09-19
    134 min

    [GVG-749]The Record Of All The Things A Private Tutor Did To A Busty Student. Yui Miho

  • miho yui censoredbig titsschoolgirlGVGglory questGVG-749GVG74913gvg00749
    • 2018-09-18
    28 min

    [n1333]Tokyo Hot Shameless Masturbation Special =part4=

  • ayaka kaneko yui kawai uncensoredtokyo hot
    • 2018-09-16
    109 min

    [DDK-179]I Brought Home This Innocent And Naive Girl Thinking That I Would Domesticate Her I Tried To Teach Her All Sorts Of Adult Stuff... But I Awakened Her Perverted Lust, And She Domesticated Me Instead Yui Miho

  • miho yui censoredcreampieslutDDKdogmanormal kimDDK-179DDK179ddk00179
    • 2018-09-16
    151 min

    [MOPE-026]Anal Fisting & Foot Fucking - How A Man Enjoys Anal Pleasure And Dry Orgasms -

  • yurigawa sara iku kuroki censoredslutMOPEm man paradisemo exMOPE-026MOPE026mope00026
    • 2018-09-16
    140 min

    [BDA-071]Female Teacher Gets Tied up and Humiliated in Her Classroom Yui Hatano

  • yui hatano censoredbukkakeBDAbermuda delusionabashiri familyBDA-071BDA071bda00071
    • 2018-09-16
    135 min

    [DDOB-036]Handjob Mommy Intense Ejaculations From Heavenly Handjobs Yui Hatano

  • yui hatano censoredsquirtingmature womanDDOBdogmatenunmy auntDDOB-036DDOB036ddob00036
    • 2018-09-16
    245 min

    [MXSPS-588]Extreme Vs. Top Class Yui Hatano And Hibiki Otsuki 4 Hours

  • yui hatano otsuki sound censoredMXSPSmaxingMXSPS-588MXSPS588h-068mxsps00588
    • 2018-09-15
    52 min

    [091518_01]Yui Asakawa

  • yui asakawa uncensored10musume
    • 2018-09-15
    191 min

    [PTS-430]Relentless Nipple Tweaking At The Married Woman Lesbian Massage Parlor A New Style Of Sensual Development Oil Massage

  • ayano kato shinoda yu censoredmarried womanlesbianPTSpetersnanzaki masakiPTS-430PTS430h-021pts00430
    • 2018-09-14
    128 min

    [TMCY-116]"My Father Told Me To Try Anything Once While You're Young" Yui Tomita

  • yu tomita censoredbeautiful girlTMCYvartanbaltanTMCY-116TMCY116h-452tmcy00116



    • Japan xxx, japanese adult videos, japani sexy, Japanese Adult Movies, JAV censored, Japanese tube, Japanese sex online