riho takahashi




FC2NNPJKSBJCESDCHRVHNDWANZRBDABWVENUDASDPREDAVSASQTESHKDNACRMARAGMEMDTTMEYDEBOD

2020-09-26
22 min

[h0930-ki200926]おしっこ特集 20歳

  • amateur uncensoredh0930
    • 2020-10-01
    63 min

    10musume 100120_01 Horny amateur girl got cum continuously at a massage shop Mao Hanada

  • amateur uncensored10musume
    • 2020-10-16
    70 min

    299EWDX-322 Kanako, 23 years old, a frustrated F-breasted wife who walks in clothes with open chest

  • amateur censoredbig titsmarried womanewdxewdx-322ewdx322299ewdx-322
    • 2020-11-13
    146 min

    [IPX-572]Adultery On A Business Trip - Beautiful Female Boss Takes Her Employee's Creampies All Night Long Iroha Natsume

  • natsume saiharu censoredcreampieblowjobIPXidea pocketzaku araidishIPX-572IPX572ipx00572
    • 2020-11-19
    120 min

    [SYKH-018]Natural Airhead Beautiful Tits Infidelity: Dirty Semen Wife, Rina 27 Years Old

  • censoredmarried womanmature womanSYKHleisure mrs emanielSYKH-018SYKH018sykh00018
    • 2020-11-21
    52 min

    FC2PPV 1578847 [Personal shooting] Mei 20 years old ★ Creampie in missionary posture to a slender female college student of shaved bread! The last is a cleaning blow job!

  • amateur uncensoredfc2
    • 2020-11-22
    138 min

    [DASD-765]Close Niece Bath Time. My Boner Won't Stop. Mahiro Ichiki

  • mahiro ichiki censoredschoolgirlblowjobDASDdasDASD-765DASD765dasd00765
    • 2020-11-23
    51 min

    FC2PPV 1581246 ☆ First shot ☆ Complete appearance ☆ Exquisite blowjob while making a jubojubo sound ♥ E cup beauty big tits fair-skinned beautiful girl JD and Icharab SEX cum shot ♥ [With benefits]

  • amateur uncensoredfc2
    • 2020-12-12
    115 min

    [MEYD-642]I Was Out Partying With This Married Woman Who I Worked With Part-Time At Our Year-End Work Party, So I Decided To Bring Her Home With Me. When She Changed Into My Room Clothes, This Married Woman Became So Irresistibly Explosive, I Got Sup

  • emi fukada censoredcreampiebig titsMEYDtameike goroMEYD-642MEYD642meyd00642
    • 2020-12-13
    151 min

    [CHRV-122]My Little Stepsister Is A Shoplifter Who Hides Her Stolen Wares In Her Cleavage, But She Didn't Realize That Hot Shoplifters Get Fucked! B Is For Busted! L Is For Loose Socks! T Is For Thong! My Little Stepsister Has Big Tits Worth More

  • censoredcreampiebig titsCHRVcherry revolution daydream tribecherry s reboCHRV-122CHRV122chrv00122
    • 2020-12-23
    73 min

    SWEET-048 Nonora

  • amateur censoredbig titsschoolgirlsweetsweet-048sweet048sweet-048
    • 2020-12-25
    126 min

    [KBI-049]Married Woman Creampie - Adultery At A Hot Spring - 4 Forbidden Creampie Loads! Someone Else's Wife Is Your Exclusive Cum Dumpster. Minami Shiratori

  • minami shiratori censoredcreampiemature womanKBIprestigeshimikkikanbiKBI-049KBI049118kbi00049
    • 2020-12-28
    59 min

    Caribbeancom 122820-001 BOGA x BOGA: Mio Futaba Praises Me

  • mio futaba uncensoredcreampiecaribbeancom
    • 2021-01-01
    482 min

    [DRC-022]Picking Up Girls Undercover At A Swingers' Party - 8 Hours

  • censoredcreampiebig titsDRCprestigedocument recordDRC-022DRC022118drc00022
    • 2021-01-01
    37 min

    359TYVM-118 Neat and clean bitch cheating wife carnivorous mala eating cum shot sex! !!

  • amateur censoredcreampiemarried womantyvmtyvm-118tyvm118359tyvm-118
    • 2021-01-07
    23 min

    FC2PPV 1635547 1800pt → 900pt [Gonzo] Call a married woman who is in an affair to her home and make a thick stranger stick and vaginal cum shot 3P

  • amateur uncensoredfc2
    • 2021-01-15
    120 min

    [MDTM-697]Always Looking Down On Me. Galactic Beauties' Service Club - Mitsuha Higuchi vol. 002

  • mitsuha higuchi censoredcreampieuniformMDTMuchu kikakutodoMDTM-697MDTM697h-585mdtm00697
    • 2021-01-23
    104 min

    390JAC-076 [Super Saddle Tide Barrage x Namanaka 6 Barrage] Badminton is not good, but SEX is the best and erotic! !! Penis mania enough to chew on Ji ● Ko! De nasty BODY that gets wet with strangling! No, I have no choice but to see this! !! Please

  • amateur censoredcreampiebig titsjacjac-076jac076390jac-076
    • 2021-01-23
    127 min

    [IKST-010]If You Want To Get Your Nookie With A Sexy Elder Sister Type, This One's For You! Mio Kayama Best Hits Collection Super Selections Just For You! Lots Of Super Rare Scenes In This Collection Of Premium Selections!

  • kayama yoshisakura censoredcreampiebig titsIKSTsuddenly eroticIKST-010IKST010h-1454ikst00010
    • 2021-01-26
    138 min

    [STARS-335]She Came So Hard With Piston-Pumping Vibrator Strokes That She Started Pissing Herself... "I Told You I Already Came!" Even After Cumming, She's Getting Her Pussy Pumped All The Way To The Core In A Super Follow-Up Piston-Pound

  • natsume hibiki censoredbig titsbeautiful girlSTARSsod createkomatsu 17sod starSTARS-335STARS3351stars00335
    • 2021-01-31
    50 min

    493PKPD-080 [Odorless] Make a female K student squid with a big cock! Convulsions climax hell

  • amateur censoreduniformamateurpkpdpkpd-080pkpd080493pkpd-080
    • 2021-02-12
    64 min

    [DHT-245]Please Introduce Me To Someone Hornier Than You! 4 A Horny Bitch's Friend Has To Be A Horny Slut Too! Anyone Can Agree, These Girls Are The Sure Thing, Guaranteed To Be A Great Fuck, No Matter How Many Times They Fuck, So Here We Are, Fu

  • censoredbeautiful girlDHThot entertainmentyen ikkiDHT-245DHT24559dht00245
    • 2021-02-19
    49 min

    FC2PPV 1692862 [No / piece] “Don’t you call me anymore？” Sakura-chan, a nursery teacher who came to SEX ignoring her boyfriend’s phone, put a large amount of vaginal cum shot in a minimum pussy holding a big cock that can not fit

  • amateur uncensoredfc2
    • 2021-02-21
    115 min

    [JUL-473]Days Of Sweat With The K-cup Married Woman Next Door Until Our Sexual Desires Are Exhausted. Ai Kano

  • ai kano censoredbig titsmature womanJULmadonnamametaro mamezawaJUL-473JUL473jul00473
    • 2021-02-26
    53 min

    FC2PPV 1702335 [Individual shooting 32] Prefectural K ③ Active model Shaved ⑯ Exposed wandering at the inn !!

  • amateur uncensoredfc2
    • 2021-03-05
    303 min

    [HEZ-257]Female Office Workers, Coworkers And Working Women! 300 Minutes For Everyone Who Gets Hard For Female Office Workers 20 Minutes

  • censoredcreampieuniformHEZhot entertainmenthotHEZ-257HEZ25759hez00257
    • 2021-03-07
    136 min

    [TSF-015]You're A Male Office Worker, But When You Wake Up In The Morning, You've Discovered That You've Become A Woman (20) A Thorough Investigation You Were Bi And Absolutely The Dominant One, But Now You're Cumming Like A Bitch And

  • ao itaba censoredcreampiebeautiful girlTSFkaguyahimept mousouzokugynecomastia reportTSF-015TSF015tsf00015
    • 2021-03-30
    140 min

    [MSFH-056]"Do Whatever You Want With My Body." Horny Guys And Girls Give In To Their Instincts And Fuck Like Animals Konomi Yoshinaga

  • konomi yoshinaga censoreddeepthroatsingle workMSFHsod createkaorums sodMSFH-056MSFH0561msfh00056
    • 2021-05-01
    120 min

    [JUL-564]Madonna Exclusive Second Release! Being Made To Uncontrollably Cum By A Man I Didn't Even Want To Sleep With... Kanna Hirai

  • shiori hirai censoredmature womansingle workJULmadonnajo asagiriJUL-564JUL564jul00564
    • 2021-05-14
    125 min

    [ARM-978]Raunchy S********ls Masturbate While Showing Off Their Stained Wet Panties

  • otohana eve hazuki peach censoredschoolgirlARMaroma planningmania satoshiaromaARM-978ARM978arm00978
    • 2021-05-28
    99 min

    [YST-244]Tanaka-san Is My Neighbor And For Some Reason She Keeps Cumming To My House And Playing With My Nipples The Entire Time (Sweating) Nene Tanaka

  • nene tanaka censoredcreampiebig titsYSTkomyoYST-244YST244540yst00244
    • 2021-06-05
    242 min

    [VENX-045]Family Fun: A Beautiful Step-aunt - Highlights 6 - 6 Hours

  • censoredcreampiemarried womanVENXvenusincestVENX-045VENX045venx00045
    • 2021-06-20
    69 min

    FC2PPV 1879604 Up to 27 1480 [No] Short stature and hairless young ○ type toys. Although she opposes desperately, she inserts raw cock and vaginal cum shot continuously.

  • amateur uncensoredfc2
    • 2021-06-22
    77 min

    FC2PPV 1881412 * Limited time price [2480PT⇒1980PT] Miss business trip Menes I took a gonzo secretly

  • amateur uncensoredfc2
    • 2021-06-25
    12 min

    FC2PPV 1870786 [4K] Overwhelming Feratech! Moe-chan’s Big Cock Swallowing Cum Blow Personal Shoot

  • amateur uncensoredfc2
    • 2021-07-04
    95 min

    DCH-005 Rin

  • amateur censoredcreampieamateurdchdch-005dch005dch-005
    • 2021-07-09
    70 min

    OREX-269 Ayumi

  • amateur censoredcreampieamateurorexorex-269orex269orex-269
    • 2021-07-10
    236 min

    [XRLE-009]Creampie Down Her Throat and in Her Pussy. An Obedient Face-Fuck. Riku Aisawa.

  • riku aizawa censoredblowjobdeepthroatXRLEreal worksani nakamurareal real worksXRLE-009XRLE009xrle00009
    • 2021-07-17
    177 min

    [CAWD-251]This Beautiful Girl With Light Skin Is An Underground Idol Who Is Getting Licked By Slobbering Otakus And Drenched In Drool And Semen As She Gets Her First Experiences In Orgasmic Ecstasy! She Came So Hard That Her Body Was Super Charged Wi

  • moeka momoyama censoredsquirtingsingle workCAWDkawaiikannana dainanaCAWD-251CAWD251cawd00251
    • 2021-07-17
    118 min

    [CAWD-258]"Boss, I'll be on a Date Until Morning." Overtime reverse Secret Sex with NTR Wife. Cumming in a Slut Who Rides Me after Making Fun of Me for Working Overtime. Sarina Momonaga.

  • sarina momonaga censoredcreampieslutCAWDkawaiitiger kosakaiCAWD-258CAWD258cawd00258
    • 2021-07-24
    240 min

    [MCSR-444]Close-up Sex Filled With Motherliness: Glossy Mother-in-laws - 12 People, 4 Hours

  • elena tachibana mizuki shoko censoredcreampiebig titsMCSRbig mocaljiro kanekomuscatMCSR-444MCSR44457mcsr00444
    • 2021-08-31
    62 min

    FC2PPV 2113329 4 Days Limited Special Price !! [Peculiar Strong Woman ＃ 012] Iku Beauty Ol 28 Years Old With A Generalized Erogenous Zone Trained Woman Endless Nipple Groping Mad Fainting Acme Broken Kimepako ♡

  • amateur uncensoredfc2
    • 2021-09-02
    105 min

    [AARM-012]When She Sees A Man With His Nipples Popping Out From Underneath His T-Shirt, She"ll Rub Her Body Against Him And Tweak His Nips And Then Stroke Her Thighs Upon His Rock Hard Cock, Just Under His Belly, And Give Him A Tweaking He"ll

  • aya mamiya ikuta miku censoredbig titsslutAARMaroma kikakuhamu oujiaromaAARM-012AARM012aarm00012
    • 2021-09-04
    144 min

    [XVSR-608]The Perverted M Lady That Gets Excited By Getting Fucked Like Crazy In A Men"s Massage Parlor

  • ichibana mogami hana sato censoredbeautiful girlsingle workXVSRmax akitorune kawaguchicalenXVSR-608XVSR608xvsr00608
    • 2021-10-01
    162 min

    [DVDMS-722]Kana (Aged 19), Member Of National Cheerleading Squad Competition Winning Team At Prestigious University Squirted For The First Time She Had Sex And Came All Over The Place!

  • censoredcreampiesquirtingDVDMSdeepssuttorune iwanagaDVDMS-722DVDMS722dvdms00722
    • 2021-10-13
    120 min

    [268SPYE-274]隠し撮り投稿 変態おやじがあとでこっそり見るように撮りためた卑猥映像集 2

  • amateur censoreduniformamateurspyespye-274spye274268spye-274
    • 2021-10-23
    117 min

    [MGMJ-052]Pantyhose and Beautiful Legs Freaks, Natsuki Nagahara

  • nagatsuki natsuki censoredslutsingle workMGMJmegamibijo shin fetishMGMJ-052MGMJ052mgmj00052
    • 2021-10-26
    83 min

    ERK-013 Nanami-Chan (Minami Hironaka)

  • amateur censoredsquirtingamateurerkerk-013erk013erk-013
    • 2021-10-29
    162 min

    [MIAA-521]The Absolute Aerial Domain She"ll Jam Your Cock Into Her Silky Smooth Cunt Crack And Between Her Thighs And Toy With You Because She"s A Devilish Barely Legal Babe Ichika Matsumoto

  • ichika matsumoto censoreduniformslutMIAAmoodyzmasaki naominna no kikatanMIAA-521MIAA521miaa00521
    • 2021-11-02
    63 min

    200GANA-2547 In The Spear Room Of The Nampa Master Of Hyakusen Hakusen, Bring In Sex Hidden Camera 225 Bring A Friendly Half Daughter Into The Room! Cum With A Sensitive And Intense Body! Rec Icharab Sex With A Hidden Camera! !! (Ran Sakita)

  • amateur censoredamateurganagana-2547gana2547200gana-2547
    • 2021-11-08
    141 min

    FC2PPV 2413747 [Former Entertainer, Current Follower Over 500,000 W Influencers] ~ Leak ~ [cen]

  • amateur uncensoredfc2
    • 2021-11-18
    105 min

    [XMOM-037]A Voluptuous Lively And Gorgeous Married Woman Sex That Feels So Good This Captivating Married Women Will Cry Chisato Shoda

  • shota chisato censoredmarried womanmature womanXMOMcenter villagesky cloudspink breathXMOM-037XMOM037h-086xmom00037
    • 2021-11-26
    91 min

    300MIUM-767 I Happened To Find The City Of Shinjuku, Which Is Crowded On The Eve Of Halloween, And I Accidentally Found An E-Cup Tipsy Beauty With A Nice Body. !! It’s The First Time For A Giant Chin For More Than 100 Experienced People! ？？ The

  • amateur censoredamateurcosplaymiummium-767mium767300mium-767
    • 2021-12-15
    512 min

    [ZAX-006]Hitting On Girls On The Way Back From A Wedding ~ Scoring With Pure Looking Women Who Are Dressed Up To The Nines ~

  • censoredcreampieamateurZAXpeters maxZAX-006ZAX006h-720zax00006
    • 2021-12-17
    118 min

    [MIDV-021]My Former S*****t Used To Be A Plain Jane, But When I Met Her Again Years Later, She Had Transformed Into A Pretty Married Woman ... Her Husband Had Committed Infidelity, So When I Propositioned Her, She Came At Me With Creampie Sex, Over A

  • mitsumi aisa mizusawa censoredlesbianMIDVmoodyzmametaro mamezawamoodyz divaMIDV-021MIDV02148midv00021
    • 2021-12-18
    53 min

    FC2PPV 2525768 A Country Girl Who Looks Like A Gravure Has Finally Fallen. It Is A Niigata Convenience Store Girl Who Is An Example Of "The First Saddle Supplement Plan Completed"! After A Rushing Vaginal Cum Shot, With A Blowjob Oral Ejacula

  • amateur uncensoredfc2



    • Japan xxx, japanese adult videos, japani sexy, Japanese Adult Movies, JAV censored, Japanese tube, Japanese sex online